SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020549 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020549
Domain Number 1 Region: 583-764
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-59
Family SPRY domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 3.77e-21
Family Pyrin domain, PYD 0.0029
Further Details:      
 
Domain Number 3 Region: 382-445
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.77e-17
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020549   Gene: ENSMODG00000016453   Transcript: ENSMODT00000020914
Sequence length 767
Comment pep:novel chromosome:BROADO5:6:147292177:147318338:1 gene:ENSMODG00000016453 transcript:ENSMODT00000020914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTLSDHLLHTLESLVAYDLEKFKFKLQTANLDKDQVRIPHGRLQNATGPVKLADLLIN
YYGERYAVKLTLQVLQAINQNLLVEELSQAITPECLTQECATEISGISAFSRTTGSKTLE
ITVPLKGILENEDANFQGPNEDIMDGIQVPISSSQLHAGQEYQEDSPETDASLVLESNRY
ENSEGFVTFGKKAYRNQAPLFLSAKRIPNQEFDDFSGEQNHPNQKSMNKEHGNSEVSVSL
GETTILYKDQVPESPKEKIFGNVDTSMLSGEKGTKDPGNWYLKEAHEDEPRLRRIPTEAF
NLLRITGAPCRAASLRRVQESCSICQAMVVNPSKISWGNHIRSHYNVGHNVCLKCQAMFP
KNFQHSRSLENIPTDYRGPKLNPQSMPQCECHPKQLQRLFCKDHGKTICLICSMSPEHRG
HRMLPIEEAAQSYKEQIQNQLEHLKKVRETAEEKKSQGNKTITAFLNKTETQKMQIMSQL
KELHDFLEKQERLFLVWLEELSKTIFRSKEDYITKASQEISLLEELMGELEEKQKQPAWE
FLQSVERSMRQFIGLYIKTWYIEKLETQLSHLIPGSGSKIPYLCFTNVTLDPETAHPKLI
ISDDRKHVRLGKKCGKVFDGPQRFNDSVIVLGYPSFTSGKQYWQVDVGDKTSWILGVCKN
SVNRKGSTAFSPGNGYWLVMMMKKNEYSASTIPPTPLSLKEPPRCVGIFMDFEAGDISFY
NVTARSHIYTFSFSSSSSGPLRPVFSPGIQDRGKNADPLTICSVNRW
Download sequence
Identical sequences F7A409
ENSMODP00000020549 ENSMODP00000020549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]