SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020571 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000020571
Domain Number - Region: 15-45
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.012
Family Myosin rod fragments 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020571   Gene: ENSMODG00000016477   Transcript: ENSMODT00000020936
Sequence length 89
Comment pep:novel chromosome:BROADO5:1:40609013:40609282:1 gene:ENSMODG00000016477 transcript:ENSMODT00000020936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELEEDFAKVLLLKEGRIKELEKRLAEKDEEIQELRRKLHKCQSVLPAPSSHMGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSER
Download sequence
Identical sequences F6ZDL1
13616.ENSMODP00000020571 ENSMODP00000020571 ENSMODP00000020571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]