SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020592 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020592
Domain Number 1 Region: 153-283
Classification Level Classification E-value
Superfamily GAT-like domain 3.41e-44
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.000000893
Further Details:      
 
Domain Number 2 Region: 23-148
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.12e-42
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.0000018
Further Details:      
 
Domain Number 3 Region: 637-729
Classification Level Classification E-value
Superfamily Prefoldin 1.52e-16
Family Prefoldin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020592   Gene: ENSMODG00000016493   Transcript: ENSMODT00000020957
Sequence length 730
Comment pep:novel chromosome:BROADO5:Un:37787502:37842776:1 gene:ENSMODG00000016493 transcript:ENSMODT00000020957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQSLTDRITAAQHSVTGSAVAKAVCKASTHEMMGPKQKHLDYLIQCTNELNMSIPQLA
DTLLERTANSSWVVVFKALITAHHLMMYGNERFMQYLASRNNLFNLSNFLDKSVIQGYDM
STFIRRYSRYLNEKALSYRLVAVDFTKMKRGSDGVMRTMGTDKLLKTLPVIQNQLDVLLD
FDAHPNELTNGVISSAFMHLFKDSIRLFAAYNEGIINLLEKYFDMKKNQCKEGLESYKKF
LGRMAKLSEFLKVAEQVGIDQADIPDLTQAPSSLFEALEQHMASLEGRKTKELLAAYRIS
HLPTAMSTLASTGKAISQVVEKQKKYPLDEDLVKLHTRKEKWLKEIPVVSDSATTSESPS
LLDPPNVTTSSVINLFGPSLPPSTSLASTSDDLFGLESAFILTPQSATTTAMGTLPSQTW
GADFHLSPLPSSAPLEVPVDFDSVFGSKSLDSEYEYGATNGRSCHSGTGSGLDEIPAPLS
ALTAQEHHEIPGSQQRGTVLVNDLDSSLANLMGNLDFGMSPQKSDIQWNQPSEKKMTGGM
NWQVKTSTATTWSPATISPVPHMVPVPVSHPVNPHPLPVYGMVQTPLGAVPLVAPQPLIY
AQPGLRTTNPFAPVSGPQEDVDAFMKQPGNESIDTVLKKLDEQYQKYKFMELNLTQKKRR
LKNQIPDIKQTLHILKYMQKKKETTKPLETRFLLADNLYCKAFIPPTDKVCLWLGANVML
EYDINEAQDL
Download sequence
Identical sequences H9H6W7
ENSMODP00000020592 ENSMODP00000020592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]