SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020741 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000020741
Domain Number - Region: 33-127
Classification Level Classification E-value
Superfamily Release factor 0.0216
Family Release factor 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020741   Gene: ENSMODG00000016618   Transcript: ENSMODT00000021108
Sequence length 254
Comment pep:novel chromosome:BROADO5:8:126753248:126778452:1 gene:ENSMODG00000016618 transcript:ENSMODT00000021108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKALADAKALVERLRDHDNAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIIMKLKEQHSKIDMVHRHHSPEGIFLGAPRRILEATQHGLERRHLEANLNELQVHVDQI
TEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLSLKKDDASESTSL
SALVTNSDLSLRKS
Download sequence
Identical sequences F6YNF0
13616.ENSMODP00000020741 XP_001362394.1.35504 XP_007503986.1.35504 XP_007503987.1.35504 ENSMODP00000020741 ENSMODP00000020741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]