SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020801 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020801
Domain Number 1 Region: 75-150
Classification Level Classification E-value
Superfamily L28p-like 0.0000000183
Family Ribosomal protein L28 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020801   Gene: ENSMODG00000016666   Transcript: ENSMODT00000021168
Sequence length 253
Comment pep:novel chromosome:BROADO5:6:149959692:149966735:-1 gene:ENSMODG00000016666 transcript:ENSMODT00000021168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLHKYPTKLWNTLKLSQGIYSRLPEHYLKSLKNEGTPTAVHYKPHGVKYKINPKNGQRE
LVQDVPIPLYFPPESQRGLWGGEGWIRGYRYTNNDKLSKRVRKTWKPHLYERELYSEILD
KKFKTMVTMRTLDLIDEAYGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARRDPQLHPDD
PEKREAIYNKYKEFVIPEDEAEWVGLTLEEAVEKQRLLEKKDPVPLFKVYVEELIQQLQE
QALSQPAVMQKKA
Download sequence
Identical sequences F7E6R6
ENSMODP00000020801 ENSMODP00000020801 XP_001365154.1.35504 XP_007499253.1.35504 XP_016279627.1.35504 13616.ENSMODP00000020801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]