SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020806 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000020806
Domain Number - Region: 430-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020806   Gene: ENSMODG00000016669   Transcript: ENSMODT00000021173
Sequence length 705
Comment pep:novel chromosome:BROADO5:6:149972847:149994419:-1 gene:ENSMODG00000016669 transcript:ENSMODT00000021173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRWLLQAFKSPGSECTDVEITVHFRYGAPPVINPLDTKFPANTTVRPSFYIKLIHNNT
IINVSSPAPGDWFIAAHLPRSPQKIEVKGVATPCTYIFQPDMLVLRLTDVTILEPNMPLT
QTLSGSQMKYLKVFIPKYTSDLQLELRSCVSNGSQVCPVRLIVGPNTLPQSFQKVFSCSD
HHEPCRLLLPAPPWDTWLQVTAEGRAEPNVSVTFDAVASFTVCRPGSLGPLVISYISLNQ
SLNASAASLSMGRSPWHLGKRMGVGRSPFSLVGDFRNASALSGFCLLSYPVIREELDVVS
VRFWPLSGSGIIVWSSLPTLFPINLNTGMDSGSTLIVILKLNTTLGSNMSVVGCLSAASP
VLSLNTSQNCTTAFSEGYSLYLSDSSREAMLSVPYPETGNWYLSLQLICPKNVSECQQVR
ANVETSLSLVPCFNDCGPYGQCRLLRRHGYLYASCTCKAGWQGWSCTDDTKAQTVVQQNL
ATLLLTLSNLMFLLPVAVAVCRRYLVEASVYTYTMFFSTFYHACDQPGVAVLCIMDYDTL
QYCDFLGSVVSIWVTILCMSRVKAHVKYVLFVLGTLIIAMSLQLDRRGIWNIMGPCLCAL
IIMITMWVYRCIHRHHCYPTSWKRWAFYLLPGISLAFVAIAIYTFMGTNDNYFYTHSIWH
VLMASSVAFLLPPREKNTEPWAWSQKLTCRYQLCKNTQEELYAVT
Download sequence
Identical sequences F7E6Q5
ENSMODP00000020806 ENSMODP00000020806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]