SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020836 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000020836
Domain Number - Region: 182-416
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0392
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020836   Gene: ENSMODG00000016696   Transcript: ENSMODT00000021203
Sequence length 473
Comment pep:novel chromosome:BROADO5:7:260605739:260640085:-1 gene:ENSMODG00000016696 transcript:ENSMODT00000021203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLSFPRLTPAEIVTHVQNSILTGADGKNLSKNDLFPNPKPEVVRRIFLRTLQIVYGIP
LDSFYMCAHPMTLEQRGMRRGIFAWFLCFLRRVGGLEDAFLRVCRVSDFEFADVLYPKGK
RTCRFLSAIINFIHFRESRREVYMDSLRHYKSSMDKMQQLHVTQQEALMKLEKLNSVPVE
EQAEFKQLSEDIQELQQTLNGFRQKTVTIQEGISQKKLDIAESTKHLNELKLSLVTLKEE
QENLKTKIVDSPEKLKNDKEKMKETVQKLKASKLEVTEKYEAYRDAIEGMPAFQMEVQLY
QKKMQELAESMDKVTRILKENQSLEDQIESAQTELKKLKAEETSLKRQVIVEKEKLATTQ
IRINKKHDDIKQYKRSVLEECNKLQEKRGAIYEQVTTINRDVQRIRLEIQQLKDITENEK
LKFQEIFLTLKSAVERYHEAMEKALEEGKARIRDKAVQLKRETLAGQPEQSCI
Download sequence
Identical sequences F7DLU6
ENSMODP00000020836 ENSMODP00000020836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]