SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020899 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020899
Domain Number 1 Region: 338-416
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.46e-25
Family Intermediate filament protein, coiled coil region 0.0000692
Further Details:      
 
Domain Number 2 Region: 108-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000785
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 3 Region: 114-221
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000432
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020899   Gene: ENSMODG00000016740   Transcript: ENSMODT00000021268
Sequence length 795
Comment pep:novel chromosome:BROADO5:1:737635109:737640540:-1 gene:ENSMODG00000016740 transcript:ENSMODT00000021268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYALESLGAPAAYRRVTETRASYSSRSGGSPSSGFRSQSWSRGSAGGGGSLSSSAMAVS
YKRAIPRSAYGGLGSALLSSAESSLDFSQSSSLLNGTAAGPDFKLVRANEKEQLQGLNDR
FAGYIEKVHSLEQQNQEIEAEIQALRQKQASHAQLGDVYEQELRELRAGLEQVNHEKAQV
QLESEHLEEDIHRLKERFDEEARLRDDTEAAVRALRKDIEEAALVRVELDKKVQSLQDEV
AFLRSNHEEEVADLLAQIQASHITVERKDYLKTDITSALKEIRSQLECHSDQNMHQAEEW
FKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEER
HNHDLSSYQDTIHQLENELRGTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR
FSTFSGSITGPLYTHRQPSVTISSKIQKTKVEAPKLKVQHKFVEEIIEETKVEDEKSEME
DALAAIEAELASTTQKAAGAKSDQAEEGGSEKEGSKSTSVKTEKAKSPAALSPPAKSPIA
KSPAAQSPPDKSPPAKSPAALSPPAKSPTTKSPAALSPPAKSPTTKSPAALSPPAKSPTT
KSPVALSPTAKSPMPKSPMPKSPMPKSPVEEVKAKVDEDEKEEVTVSEGEKVSKEEKKEE
SPKEVPEKKKAGSPVKETAAEEVDTVSKSTKVGAEKEAEEEEGGSEEGSDQGSKGPAEEK
KEGGDKSEEKIVVTKKIEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVE
KVTSHAIVKEVTQSD
Download sequence
Identical sequences F7BYP0
ENSMODP00000020899 ENSMODP00000020899 13616.ENSMODP00000020899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]