SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020924 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020924
Domain Number 1 Region: 3527-3702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-28
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 3353-3515
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-27
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 3130-3300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.24e-22
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 4 Region: 2949-3124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000297
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 2741-2928
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000176
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 6 Region: 1976-2031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 7 Region: 1928-1978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 8 Region: 1447-1495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 370-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.047
Further Details:      
 
Domain Number 10 Region: 553-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 11 Region: 1537-1588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 12 Region: 689-737
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 13 Region: 1586-1634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 14 Region: 311-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 506-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 16 Region: 786-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 17 Region: 1869-1914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 18 Region: 644-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 19 Region: 736-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 20 Region: 599-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 21 Region: 2030-2079
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 22 Region: 440-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 23 Region: 839-878
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 24 Region: 2077-2126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000020924
Domain Number - Region: 1831-1871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 2205-2403
Classification Level Classification E-value
Superfamily Tropomyosin 0.0157
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020924   Gene: ENSMODG00000016753   Transcript: ENSMODT00000021293
Sequence length 3703
Comment pep:novel chromosome:BROADO5:1:477575281:477714071:1 gene:ENSMODG00000016753 transcript:ENSMODT00000021293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWGAGHRRGDGSPCALSLLLLLLLFLGGGAGAPETGGEGSGDLGSEGGGFSLHPPYFN
LAEGARISASATCGEEAPAGARGPSRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTSA
NINKAHPITNAVDGTERWWQSPPLSRGLEYSEVNVTLDLGQLFHVAYVLLKFANSPRPDL
WVLERSTDFGLTYQPWQYFASSKRDCIEKFGFQTLERINKDDDVVCTTEYSRIVPLENGE
IVVSLVNGRPGAMNFSYSPLLRNFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYY
SIKDISIGGRCVCNGHADVCNAKDPTDPYRLQCACQHNTCGGACDHCCPGFNQLPWKPAT
MDNANECQSCNCHGHAHDCYYDPEVDRHRASKNQDNIYEGGGVCIDCQHHTTGINCERCI
PGYYRSPDHPIDSPYVCYRCNCESEFTDGTCEDLTGRCYCKPNYTGELCDACAKGFTDFP
HCYPVPSFSHNDTGAQVLPAGQIVNCDCSAAGTLGNACRKDPQVGQCVCKPNFQGVHCEQ
CAPGHHGPGCLPCRCSGPGQKGDTCDDETGQCVCRTGFEGPACDRCAPGYFSYPLCQLCG
CSPVGTLPEGCDESGRCLCRPEFDGLHCDSCRVGYHSYPHCQVCSCDPRGSLDQFCSGAG
MCHCRPGYAGSMCQECAPGYYGFPNCMSCHCSEAGSFHATCHPETGQCSCRPRVSGVHCD
TCVPGTYGFPRCEVGSCDPAGQASGNSSLSQGSCECRAHVEGPKCDRCKPLYWNLSPANP
FGCRSCSCDPRGTINGVAECQQGNGQCFCKPNVCGQMCTVCKDGYFRLDQADYFGCQTCQ
CDIGGALAQGCEPRTGACQCRPNTQGPTCSEPARDHYLPDLHHLRFELEEGSTPDWRPVR
FGYNPLEFENFSWRGYAQMTLVQPRVVVKLNVTSPDLFHLVFRYVNRGPTSVNGKVSVFE
EGKFNACSNCTEQSHWVTFAPSTEPVFLTVPQSSYGEPFVLNPSIWSLVIEAEGVLLDYV
VLLPSAYYEAPILQLKVTEACTYNPKPEQKWNNCLLYTYLPLDGFPSASGTDAICRRDNS
LPKACQMEQISSSHPPLASCWGNDVDVQLQMVVPQPGQYALIVEYANEDDLQDVSVTVHT
PQWILQQGLLTLYPCQYSFLCRGTALGSQNRLAAFELTGEASIQLTAEHAQFLLYRIYLV
PINKFTTEFVEPRVHCISSHGTFGPSSGSCIPSRFQKLSQPIVLTECRVLPVPPDFPLSH
MHTVTPAGPPTSPQPRPPTAVDPASNPTLLHSSQSTVVFSTHIQTLGRYAFLLHGYQPNH
PTFPVEVLINGGRIWHGQANASFCPHAYGCRSLVVCEGQIILDVTDNELTVTVRVPEGQQ
LWLDYVLVVPEDGYSSSYLREEPLDKSYDFISLCAANGFYISPSSTPFCQNAAISLSLFY
NNGAQPCYCHEVGATSPTCEPFGGQCSCRAHVIGRDCSRCATGYWGFPNCRPCDCGTRLC
DEVTGQCICPPRTILPDCVVCQDQTFGCHPLIGCEDCNCSRPGVEELTDPGCDLDSGQCK
CKPNIIGRRCDACAPGFYGYPNCRRCQCFEAGTVAGVCDPITGQCHCKDNVEGLRCDQCR
VGTFSLDATNPKGCTRCFCFGATDRCRSSQQVRGELLDMQGWVLLSGERQEVPTSLRADI
GLVHADVRNVPEAFQDLYWQAPVCYLGDRVSSYGGRLSYELHSETQRGDVFVPTESRPDV
ILKRNQMSITFLESSYPAPGYIHRGKVDLVEGNFRHTETHNPVSREELMMVLAGLEQLQI
RALFSQISSAVSLQRVVLEVVTDAPGGAQASNVEVCMCPANYRGDSCQECASGYYRDTKG
HFLGKCIPCHCNGHSDRCLPGSGICVGCQHNTEGDHCERCKGGFVINTTQDQSSSLCVSC
PCPLSVPSNNFAVGCVHKGGITQCLCQPGYAGASCQRCAPGYYGNPLVIGSSCQPCDCSG
NGDPNMLFSHCDPLTGACLGCMYNTAGPHCESCAPGYYGNALLPGNCTKCDCSPCGTEAC
DARSGRCLCKAGVTGPRCDRCQDGYYGFDGCGGCQPCNCGPAAMGPSCHPQSGQCHCRVG
VSGAQCQQCAPGYWGFSEHSCTRCPCRGGHCDPRTGECTCPPGLSGKQCDSCSHQHQVPV
THGPGGVHCEVCDNCVVLLLDDLERMEPLFPAIRQQLSSLNASSMAWTRLHGINSSIVAL
ADQLRGPAGSREPTRQRLDELERQSGVLDEETEVLHSKVAKAQARAGQLPENSRDNLQRA
KALLPNIPNMERALGELISQMDRLSPSNASAASGEEFLRTLGEVERMLQEMRGRDFGGPR
AVAEGELREAQSLLNRVQSQLTSRWEESQALASSIRERLAQHNSQLMDLRDALNEAVNKT
RLTEELNSRNQGYLEERLQKKQELERENSTLRDILRMAEDALAQVSELLQTMDRAKEEYE
HLAANLDGARTPLIEKMQKFSPASSKIPIVERAEEHAQELDQLAYNLSSIIRDTNQDRFI
QRAIEASNAYASILQAVGKAEAAANQALQNATSTWRMVIHGGLNARARELRENSSILEEA
VRNQQKKLSGAIRETLQASRTQLEEAKAKKDRLVAQLKGVQSMLAMDRDDTSEKIARAKA
MAIEANDTATQVGATLRDMQRNLHQWQDQYGNLRNQDLAQAMEDAGKSVYSLEKTLPQLL
AKLSHLENKRGQNASLALSNSILRVRELITQARSAASKVKVPMKFNGRSGVQLRPPRDLQ
DLAAYTALKFYIQSSEPPQQQGQDGSSQFVLYMGSHEASGDYMGVVLREHKVQWVYRLGE
ADHRTLTIDEDIGEQFATVSIDRILQYGHMSVTMEKQTVHETKGDSVYPGDQGLLNLRPQ
DFVFYVGGYPSNFTPPVPLRYPGYRGCIEMDTLNEEVMSLYNFLRTFHLDTATDKPCARS
KSTGDPWLTDGSYLDGTGFAHISFESQMSSTKRFEQELRLVSYTGIIFFLQYQGQFLCLA
VQEGRLVLYYDFYHGLQTATPQQELAPLTSSNKAIQIFIMGGAGRKRVLVRVERVSVFSL
QEENMLENADSYYLGGVPLAQLPSSLRPLFPTGGSIRGCVKGLKALGKYVDLKRLNTTGI
SSGCTSDLLITRSMTFHGHGYLTLALRDVPPLTGNFYTGFGFRSTQDSGLLYYHASPEGI
FQVSLRQGRVTLKFRRSEVMTRGAYADGAAHYVAVYSNDTGVWLYVDDQLQGTERQGGRS
QRQAATEGPPRFLLGGLPESGAFQNLTGCISNVFVRRVSEAQHVVDLQQNIQNINVTTGC
TVLDQPLQLRVSPRKFRRKPKAALHDLDSPPDAACQISAHPKTISNAYQLGASPGSHLQF
AHVPFSFQERTHFFMDIRLRSPQGLLLAVPTVESGSPFLVLYLSHGHFVLQAGGQGKPFR
IRSRERYKTGGWHAVFISREQNRIQLVIDGLRAQSSKGPPGRRKALLGHGPIYVGGLPSG
HSWTHLPEAAGSAFKGCIRNLKLNGQPLEAPTQLQGVVPCYTGALEKGLFFAAEGGAVVL
DPPSGDGPELELMLEVRPWAAAGLIFHLGSGQRPPYVRLQADADKVLIRANTGAGEFSVS
VARPPLCDGLWHRIAVIKGRNMIQLDVDTEGNYTVGPALVPSIITKEPLYLGGLPETSKG
TSPSSPPGYHGCMRNLVINRHPIDLTHTGTVRGSVGASGCPVM
Download sequence
Identical sequences F7GGL1
ENSMODP00000020924 ENSMODP00000020924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]