SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020935 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020935
Domain Number 1 Region: 53-300
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.25e-72
Family Crotonase-like 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020935   Gene: ENSMODG00000016770   Transcript: ENSMODT00000021304
Sequence length 301
Comment pep:novel chromosome:BROADO5:8:135527371:135566314:1 gene:ENSMODG00000016770 transcript:ENSMODT00000021304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALSLLAVRALWPSRLLSCGRALLSSSVCSRGAAEARQPQPEQRLTSCRQLDGIRTII
LNNPKKRNALSLHMLKSLRNDILHDAESKDLRVIIISAEGPVFSSGHDLTELSDEQSQNY
HAEVFRTCAEVMMLIQKHPVPIIAKVNGLATAAGCQLVASCDIALASEKSHFATPGVNVG
LFCSTPAVALGRAVPRKVALEMLFTGEPITAQEALLHGLLSKVVPEEKLEEETMRIAKKI
CTLSRSVVAMGKATFYKQLSQDIKTAYYLTSQAMVDNLASQDGQEGISAFIQKRKPVWSN
S
Download sequence
Identical sequences F7GGC2
XP_007504012.1.35504 ENSMODP00000020935 ENSMODP00000020935 13616.ENSMODP00000020935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]