SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020958 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020958
Domain Number 1 Region: 209-299
Classification Level Classification E-value
Superfamily PKD domain 0.00000000327
Family PKD domain 0.0087
Further Details:      
 
Domain Number 2 Region: 310-347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020958   Gene: ENSMODG00000016792   Transcript: ENSMODT00000021328
Sequence length 501
Comment pep:novel chromosome:BROADO5:2:429501368:429598640:-1 gene:ENSMODG00000016792 transcript:ENSMODT00000021328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAMAWTLQGSRTRGQQVRLLGLPLLLGVWLLGQAADGQRSAPLAELRSSISGVEELLEE
FRKQLQQEPPGRETEESDDNRELPQRRAGSEAGCPGGGYTVKPDSIIRTKDSLGAGATFL
TAPAAVRDWQQCVAACCAEPLCTVAVVELPQLQASSDLNCYLFNCTYRGRNVCKFSMHQG
YNSYSLSLAAENHRNTTSRPDSPRLEYDEPPHSKAGQDVVLQLPTDWVTLDGRESTDDHA
IIKYEWTLQQGDSSLDMKVPQSGVLKLSHLQEGVYIFQLTVTDSAGQRSSDNISVTVLPK
AETAVECLKVCSRYHFFCDDGCCIDITLACDGVDQCPDRSDEAFCQSVSPGRKTITHAAA
SPAQQRTVGLTEDSDRSLSSQNSQKATRKQLFSSANSVKSNHSVSQGPKNQMNALMPDSS
PSGKDTEEKEGNYIPESKNNRIGEHPIPETGAVLPLALGLAITALLLLMIACRLRWVRQK
LKKARPITSEESDYLINGMYL
Download sequence
Identical sequences F7G668
ENSMODP00000020958 ENSMODP00000020958 13616.ENSMODP00000020958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]