SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021009 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021009
Domain Number 1 Region: 664-687
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000863
Family Ran binding protein zinc finger-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021009   Gene: ENSMODG00000016831   Transcript: ENSMODT00000021379
Sequence length 696
Comment pep:novel chromosome:BROADO5:2:428994984:429103214:1 gene:ENSMODG00000016831 transcript:ENSMODT00000021379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTKYLYGEGDL
NFSDDSGIAGLRNHMTSLNLDLQSQNVYHHGREGSRMNGSRTLTHSISDGHLQSGQSNSE
LFQQEPQTAPAQVPQGFNVFGMPNTSGASNSTPHLGFHLGSKGVSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPGLNSPQGNSIYIRPYITTPSGTTRQTPQHPGWVSQFN
PMHPQQVYQPSQPSPWTTYPASNPMSHTSTQQTNQQGHQTSHVYMPISSPTTPQPPTIHS
SGSSQSSAHSQFNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGSRTSNNPSSVNSHTL
TRSQPTVYIAASPPNSDEVISRSQPKVYISANATTGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAVGNNTTATSPRVVVTQPNTKYTFKITVSPNKPPAVSPG
VVSPTFELTNLLNHPDHYVETEGIQHLTDPVLAHVDRISEARKLSMGSDDAAYTQALLVH
QKARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCN
RQLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRPIAKTPKSQD
TEEDEGAQWSCTACTFLNHPALIRCEQLIKHGDVLF
Download sequence
Identical sequences F6R2J2
ENSMODP00000021009 ENSMODP00000021009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]