SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021037 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021037
Domain Number 1 Region: 124-333
Classification Level Classification E-value
Superfamily vWA-like 5.7e-57
Family Integrin A (or I) domain 0.00037
Further Details:      
 
Domain Number 2 Region: 356-523
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 627-804
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-19
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 536-622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000188
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 825-962
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000712
Family Leech intramolecular trans-sialidase, N-terminal domain 0.096
Further Details:      
 
Domain Number 6 Region: 1-72
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000518
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021037   Gene: ENSMODG00000016855   Transcript: ENSMODT00000021407
Sequence length 1276
Comment pep:novel chromosome:BROADO5:1:474314634:474382877:-1 gene:ENSMODG00000016855 transcript:ENSMODT00000021407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLTVLSEDRLQMKWKESEGNTNGYKVQVKPMAGRDSEQEVMLTTKTPKVTVVGLSPTKE
YTLQIFALSGSRDTLLARRRFVIEDLKSISTGRNSRKPSGETLEFIPSSVGNHEFDQVPE
LEVASPTWSGVSPTLAVSASIFQGPQFYCDTSIPVDIVFLVDGSWSIGRSNFRLIREFLA
NVISPFHIAQDKVRIGLSQYSGDPRTEWNLNSFSTKEDILEAIRNLRYKGGNTFTGLALT
HVLEQNLKLEAGSRSEAVKVVILLTDGKSQDDAGLAAQVLKDVGIDIFAIGVKNADESEL
THLASLPLDVTVHNVLDFPLLGNLTSRLIRLLCWKIQERSRSRDPGEGIHLWPHPSPTNL
IVSEVTASGFRLAWTPPLEPARKYRIIYHPSRGGTPREVTVEGATSSAQLLNLTSNTEYL
VTVFPVYKDGVGEGLRDIVTTLPLSPPSSLTIFSVDHNSIHLTWKPSNKATEYLVHCTSS
ASLREQEADEEEEVRDPEVLLKGLAPGTEYSIAVYALFGEEISEPQSIQAKTLSLDLPKH
LSFSEVSHSSVRVHWEASLRGVRMYHVSYVSLEGNQAGEIDVSRNASSVNLAPLSSSTSY
IVSVTSVYKDGDSSTLTGRVTTRKVPAPSHLKVTELPGDDVRLEWAAAAASGVVVYQIKW
TPLGEGKAYEISVPGNLGTATLPGLGKHAEYEISILAYYRDGARSDTVSLQYTPNNVFSA
AVSRNPPLNLVLASETPSSLRILWTSPNDNVLHYRLTYALASGSGPEKTIIVPGPENHVT
LPLLLPGTKYKVMVSAVYSLGESKVVSAIGRTAACPALHANNSLPGFDMMEAFGLVEKYA
SIKGVSVEPSIFSGTRIYTLFRDVQLMRRARAREIHPAALPPEHTISFLLRVLPETPREP
FALWQITDETFEPLLGVTLDAGRKSLAYFNRDHKAELQEVTFDLQEVKKIFYGSFHKVSI
LLRRLALYQFMQIFVSLNPLIMGLSSTYSLNVSLMVRRRRTVTPRQADYHCWNGVSWARK
MGKCFLSFQRDAETCPALASTCTCSLDQPGPPGPPGPPGTPGRRGIQGEQGTPGPRGEPG
PPGQTGPEGPGGQQGSPGTQGLTVQGPVGPPGLKGEKGDIGHPGLQGHPGHQGPPGRHGL
QGPKGMRGFEGTAGFPGPPGPRGFQGIAGARGINGEKGSPGDVGPTGLPGPKGERGEKGE
PQSLATIYQLVSQACEQLIQTHVLKFDPYLHENTRPPVPVWEEDVKPGKPGLPGLPNLPG
QKGDRGKDGFPGERGR
Download sequence
Identical sequences F6QH03
ENSMODP00000021037 13616.ENSMODP00000021037 ENSMODP00000021037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]