SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021064 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021064
Domain Number 1 Region: 277-689
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.19e-86
Family Amylase, catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 692-789
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.16e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.0042
Further Details:      
 
Domain Number 3 Region: 163-272
Classification Level Classification E-value
Superfamily E set domains 4.2e-18
Family E-set domains of sugar-utilizing enzymes 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021064   Gene: ENSMODG00000016876   Transcript: ENSMODT00000021434
Sequence length 794
Comment pep:novel chromosome:BROADO5:7:4116175:4352123:-1 gene:ENSMODG00000016876 transcript:ENSMODT00000021434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPGSCTARSQKRAEQTARQSACPTGGSRKVSLLPLSGWGGVGQRRKVGGRGARSTKYKK
RRVAATERQGFSTLTPPSPRLGSGSTRPCRASAAQGCGGKMAAPAGGAEAALAAALADVP
ELSRLLEIDPYLKPYAGDFQRRYKLFTQTLKEIEEKEGGIKKFSKSYESFGVHRCADGGL
YCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLEYGKWELYIPPKHDKTSIVPHGSKLKVVV
TSKSGEILYRISPWAKYVAREGDHVTYDWIHWCPEHPYRHQHPRPAKPRSLRIYESHVGI
SSHEGKVASYKHFTCNVLPRIKDLGYNCIQMMAVMEHAYYASFGYQVTSFFAASSRYGTP
DELKELVDVAHSMGIIVLLDVVHSHASKNSEDGLNPSWTDSCYFHLDERNHDLWDSNLFA
YSSWEVLRFLLSNLRWWLEEYCFDGFRFDGVTSMLYHHHGMGQGFSGDYSEYFGLQVDED
SLVYLMLANHLVHTVHPDCITIAEDVSGMPALCSPITQGGGGFDYRLAMAIPDKWIQILK
ELKDEDWNMGNIVHTLTNRRYLEKGIAYAESHDQALVGDKTLAFWLMDAEMYTNMSVLSP
LTPVIDRGIQLHKMIRLITHALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFH
LTDDELLRYKFLNDFDRDMNKLEERCGWLAAPQAFVSEKHEGNKVIAFERADLLFLFNFH
PEKSFTDYRVGTPSPGKYPFFLDTDEGRYGGHQRLDHNTDFISEPFGHHGRPCSLLVYLP
SRVGLVLQNVDLPN
Download sequence
Identical sequences F6Y1A2
ENSMODP00000021064 ENSMODP00000021064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]