SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021144 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021144
Domain Number 1 Region: 403-550
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 9.42e-51
Family Lamin A/C globular tail domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 306-382
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.41e-18
Family Intermediate filament protein, coiled coil region 0.0000209
Further Details:      
 
Domain Number 3 Region: 30-62
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000628
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021144
Domain Number - Region: 121-214
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00523
Family Myosin rod fragments 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021144   Gene: ENSMODG00000016946   Transcript: ENSMODT00000021517
Sequence length 663
Comment pep:novel chromosome:BROADO5:2:190977095:191002709:1 gene:ENSMODG00000016946 transcript:ENSMODT00000021517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPSQRRATRSGAPAGSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
AKKEGDLLSAQARLKDLEALLNSKEAALSTALSEKRTLDGEVHELRGQVAKLEAALSEAK
KQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDSGKQREFENK
LADALQDLRAQHEEQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLSAKEAKLRDLEDALARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRTSSHSSHSQSGGSVTKKRK
LETSESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSLGNWQIKRQNGDEPLLS
YRFPPKFTLKAGQVVTIWASGAGATHSPPTDMVWKAQSSWGCGNSLRTALISATGEEVAM
RKLVRTVTVNDDDEDEDGEVLLHHHHGAHCSGSGDPAEYNLRSRTVLCGTCGQPADKSGS
GAGAGAGGSVSSASSASSVTVTRSYRSVGGTGSSGFGDSLVTRSYLLGNSRPRTQTPQNC
SIM
Download sequence
Identical sequences F6V6C6
ENSMODP00000021144 XP_001367284.1.35504 XP_016285901.1.35504 ENSMODP00000021144 13616.ENSMODP00000021144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]