SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021153 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021153
Domain Number 1 Region: 611-815
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000000249
Family Mannose 6-phosphate receptor domain 0.0056
Further Details:      
 
Domain Number 2 Region: 230-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000534
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 539-619
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000141
Family Growth factor receptor domain 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021153
Domain Number - Region: 40-69
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0612
Family TNF receptor-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021153   Gene: ENSMODG00000016956   Transcript: ENSMODT00000021526
Sequence length 968
Comment pep:novel chromosome:BROADO5:8:139911097:140026317:1 gene:ENSMODG00000016956 transcript:ENSMODT00000021526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQRDYHFEYTECDSSGSRWRVAVPNSAVDCSGLPDPVKGKECTFSCASGEYLEMKNQVC
SKCEEGTYSLGSGIKFDEWDELPAGFSNVATFMDTETGPTENKPDSCDNSSWIPRGNYIE
SNRDDCTVSLIYAVHLKKSGYVFFEYQYIDNNIFFEFFIQNDQCQEMDSTTEKWVKLTDN
GEWGSHSVMLKSGTNILYWRTTGILMGSKVVKPVLVKNITIEGVAYTSECFPCKPGTFSD
KPGLSHCQVCPRNTYSEKGAKECIKCKDTQFADEGSSQCLERPPCTQKDYFQIHTPCDDE
GKTQIIYKWIEPKICQENLSEAVRLPPSGEKRDCPPCNPGFYNNGSSSCNPCPPGTFSDG
TQECKACPAGTEPALGFEYKWWNILPANMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAGG
SDNDYLILNLHIPGFKPPTSMTGATGSELGRISFIFETICSADCVLYFMVDINRKSTNVV
ESWGGTKEKQSYTHIIFKNATFTFTWAFQRTNQGQDSRRFINDMVKIYSITTTNAVDGVA
SSCRACALGSQQSGSSCVPCPPGHYIEKETNQCKECPPDTYLSIHQVYGKEACIPCGPGS
KSTQDHTLCYSDCYLSYVKENQSLHFDFSNLSSVGSLMNGPSFTSKGTKYFHFFNISLCG
HEGKKMAICTNNITDITVKEMVAESEDYTNFVGAFICQSTIIPSESKGFRTALSSQSISL
ADIFLGVTVESTLYNINIKEDMFPAPLRQIPDVHFFYKSSTVTSSCYNGRVAVVTMRCNP
SKPGQGVISVPSTCPAGTCDGCTFYFLWESAEACPLCTEHDYHEIEGACKRGFQETLYVW
NEPKQCIKGVFLPEKRLTTCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKYS
KLVMTANAKECELPAADSCAIMEGEDNEEEVVYSNKQTLLGKLKSLATKEKEDHFESVQL
KSSRSPNI
Download sequence
Identical sequences F6V5K9
13616.ENSMODP00000021153 ENSMODP00000021153 ENSMODP00000021153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]