SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021158 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021158
Domain Number 1 Region: 36-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-113
Family L-arabinose binding protein-like 0.00000000625
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021158
Domain Number - Region: 506-549
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0659
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021158   Gene: ENSMODG00000016960   Transcript: ENSMODT00000021531
Sequence length 879
Comment pep:novel chromosome:BROADO5:8:140032961:140339167:-1 gene:ENSMODG00000016960 transcript:ENSMODT00000021531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMLTRLLVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGIEECGRI
NEDRGIQRLEAMLFAIDEINRDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATSEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRFNASFTWIAS
DGWGAQESIVKGNEHVAYGAITLELASHPIREFDRYFQSLSPYNNHRNPWFRDFWEQKFQ
CSLQGKRSHRRTCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCE
AMKILDGKKLYTDYLLKINFTAPFNPNKGTDSIVKFDTFGDGMGRYNVFNFQYIGGKYSY
LKVGHWAETLSLDVSSIHWSRNSIPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCVDCGPGQWPSPDLSSCFDLPEDYIKWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICTLRRLGLGSSFAVCYAALL
TKTNCIARIFNGVKNGAQRPKFISPSSQVFICLSLILVQIVVVSVWLILEAPGTRRYTLP
EKRETVILKCNVKDSSMLISLSYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
Download sequence
Identical sequences F6V5G0
13616.ENSMODP00000021158 ENSMODP00000021158 XP_001364143.1.35504 ENSMODP00000021158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]