SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021177 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021177
Domain Number 1 Region: 28-163
Classification Level Classification E-value
Superfamily Stathmin 8.24e-58
Family Stathmin 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021177   Gene: ENSMODG00000006671   Transcript: ENSMODT00000021550
Sequence length 168
Comment pep:novel chromosome:BROADO5:3:154634075:154673654:-1 gene:ENSMODG00000006671 transcript:ENSMODT00000021550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPVSEAPRTL
ASPKKKDVSLEEIQKKLEAAEERRKTQEAQVLKQLAEKREHEREVLQKALEENNNFSKMA
EEKLILKMEQIKENREANLAALIERLQEKERHAAEVRRNKELQVELSG
Download sequence
Identical sequences F6ULZ7
ENSMODP00000021177 ENSMODP00000021177 XP_007486981.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]