SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021249 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021249
Domain Number 1 Region: 494-721
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-59
Family Eukaryotic proteases 0.00000000607
Further Details:      
 
Domain Number 2 Region: 111-208
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-35
Family Kringle modules 0.0000069
Further Details:      
 
Domain Number 3 Region: 209-294
Classification Level Classification E-value
Superfamily Kringle-like 2.25e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 301-385
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 379-476
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-28
Family Kringle modules 0.00044
Further Details:      
 
Domain Number 6 Region: 35-124
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 7.06e-23
Family Hairpin loop containing domain 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021249   Gene: ENSMODG00000017029   Transcript: ENSMODT00000021622
Sequence length 729
Comment pep:novel chromosome:BROADO5:8:147583874:147686642:1 gene:ENSMODG00000017029 transcript:ENSMODT00000021622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTQLLPILVLHQVLQHLLLLPITISFAEAQRKRNTLHEFKKSAKTTLIRLDSSLNIKT
KRLNTTDKCAKRCIRNKGLPFTCKAFAFDKAKKRCHWFPFNSMSNGVRKKHDHEFDLYEN
KDYIRNCIIGKGGSYKGTISITKSGIKCQPWNSMIPHEHGFLPSSYRGKDLQENYCRNPR
GEEGGPWCFTSNPEVRHEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTPH
RHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSTMNNSEIPME
TTHCIRGQGEGYRGTVNTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAE
SPWCFTTDPNIRIGYCSQIPKCDVSSQQDCYRGNGKNYMGNLSRTRFGLTCSMWDKNMED
LHRHTFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVNLD
HPVISCAKTKQLRVVNGIPTQTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRTK
DLKDYEAWLGIHDVHGRGEEKHTQVLNISQLVYGPEGSDLVLLKLARPAVLDDFVSTIDL
PNYGCTIPEKTTCSVYGWGYTGLINFDGLLRVAHLFIMGNEKCSQYHQGKITLNESEICA
GTEKIGTGPCEGDYGGPLVCEQHKMRMVIGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKI
ILTYKVPQS
Download sequence
Identical sequences F6Y0F0
ENSMODP00000021249 ENSMODP00000021249 XP_001370049.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]