SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021274 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021274
Domain Number 1 Region: 337-546
Classification Level Classification E-value
Superfamily vWA-like 4.87e-59
Family Integrin A (or I) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 3-192
Classification Level Classification E-value
Superfamily vWA-like 9.46e-55
Family Integrin A (or I) domain 0.0002
Further Details:      
 
Domain Number 3 Region: 236-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 556-581
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000824
Family Chicken cartilage matrix protein 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021274   Gene: ENSMODG00000017050   Transcript: ENSMODT00000021648
Sequence length 581
Comment pep:novel chromosome:BROADO5:4:431579949:431612143:1 gene:ENSMODG00000017050 transcript:ENSMODT00000021648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHLCRTRPTDLVFIIDSSRSVRPHEFEKVKVFLSQVIESLDVGPNTTRVGVINYASAVKH
EFPLKAHRSKASLLQAVRKIEPLSTGTMTGLAIQFAINKAFSEVEGSRLKFPEISKVAIV
VTDGRPQDGVKDVSARAKQSGIELFAIGVGRVDKHTLRQIASEPLDDHVDYVESYSVIEK
LSKKFQEAFCGEEKTSGQREPSPLKLKCSSIISSFLGGSGTGAGRSLSTSLTVVSDLCAT
GDHDCQQICNSSPGSYTCSCRDGFTLNSDGKTCIMPSPSSFSVFSHSCSHQLPCAPPDPS
VLISSRKGGEILAIGRPLYYFSYYHIDNCLLCQCRRLALRLSCIISLLFFPSQFLSPACN
GAAGGSATDLVFLIDGSKSVRPENFELVKRFINQIVDSLDVSDKLAQVGLVQYSSSVRQE
FPLGRYKTKKDIKAAVKKMSYMEKGTMTGAALKYLIDNTFTISSGARPGAQKVGIVFTDG
RSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELREIASEPVAEHYFYTADFKTINQIGKK
LQKKICVGEGQDQGQESEDPCACESIVKFQTKVEELLQALT
Download sequence
Identical sequences F6RUV2
13616.ENSMODP00000029292 ENSMODP00000029292 ENSMODP00000021274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]