SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021315 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021315
Domain Number 1 Region: 397-787
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.3e-130
Family Ankyrin repeat 0.000000000161
Further Details:      
 
Domain Number 2 Region: 39-412
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.43e-112
Family Ankyrin repeat 0.000000114
Further Details:      
 
Domain Number 3 Region: 4002-4112
Classification Level Classification E-value
Superfamily DEATH domain 2.27e-25
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021315   Gene: ENSMODG00000017079   Transcript: ENSMODT00000021689
Sequence length 4292
Comment pep:novel chromosome:BROADO5:1:37531384:37809033:1 gene:ENSMODG00000017079 transcript:ENSMODT00000021689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDANASYLRAARAGNLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELIHRD
ANVDAATKKGNTALHIASLAGQTEVVKVLATNGANLNAQSQNGFTPLYMAAQENHLEVVK
FLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKA
AALLLQNDSNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASK
RGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSP
LHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKILLDKKANPNAKA
LNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHANIVSQLMHHGA
SPNTTNVRGETALHMAARAGQSEVVRYLVQNGAQVEAKAKDDQTPLHISARLGKADIVQQ
LLQQGASPNAATTSGYTPLHLSAREGHEDVASVLLDNGASLAITTKKGFTPLHVAAKYGK
LEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHI
AAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGLVDMVSLLLSRNANVNLSNKSG
LTPLHLAAQEDRVNVAEVLVNQGAAIDAPTKMGYTPLHVGCHYGNIKIVNFLLQHYAKVN
AKTKNGYTPLHQAAQQGHTHIINILLQNNASPNELTVNGNTALAIAKRLGYISVVDTLKV
VTEETMTTITVTEKHKMNVPETMNEVLDMSDDEVRKANTPEMLSDGEYISDVEEGEDAMT
GDTDKYLGPQDLKELGDDSLPAEGYIGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMI
EELLVPSKDQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSM
RGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFL
GPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEEL
GKKRICRIITKDFPQYFAVVSRIKQESNQMGPEGGILSSTTVPLVQASFPEGALTKRIRV
GLQAQPVPEEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVANGYKGD
NTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDSVSFTTNVSARFWLADCHQVMETVGL
ASQLYRELICVPYMAKFVVFAKMNDPLESSLRCFCMTDDKVDKTLEQQENFEEVARSKDI
EVLEGKPIYVDCYGNLAPLTKGGHQLVFNFYAFKENRLPFSVKIRDTSQEPCGRLSFLKE
PKTTKGLPQTAVCNLNITLPAHKKETESDPDDETEKADRRQSFASMALRKRYSYLTESGM
IERSAGTTRSLPVTCSSYKSFFSTRPYQSWTTAPMTVPGQTKSGLTSLSNSSSNTPSASP
LKSIWSVSSPSPIKSTLGASTTSSVKSISDVASPIRSFRTVSSPIKTVVSQPPYNIQVSS
GSLVRTPTITEAAITPLKGLASSSAFSSRTSPVTTAGSLLERSSITMTPPASPKSNINMY
TSTLPFKSIITSAAPLVSSPLKSVVSPAKSAVDAVSSTKVMVASSLSSPVKHMTGHAEVA
LVNGSISPLKYPSSSALINGAKASATATLQEKISAATNSISCGVSAAADTVEKVFSTTSA
MPFSPLRSYVSSAPSAFQAMRTPSVSALYTSLGSSISATTSSVTSSTITVPVYSVVNVLS
EPALKKLPDSTSITKSAAALLSPIKTLTPETRPQPHFNRASSPMKSSLFLSPSALKLSTP
SSLSSSQEILKDVAEMKEDLIRMTAILQTDVAEEKPFQPEPTKEGRIDDEEPFKIVEKVK
EDLVKVSEILKKDVCVESKGASVVSKNDKGHSAEEDWTEFSSEEIKEARQQASPCPLASA
PEKVQIKAKTTSEKDYNLTKVIDYLTNDIGSSSLTNLKYKLEDAKKDGEERQKRILKPAI
ALQEHKLKMPPASMRPSTSEKELCKIADSFYGTDTILESPDDFSQHDQDKSPLSDSGFET
RSEKTPSAPQSAESTGPKPLFHEVPIPPVITETRTEVVHVIRSYEPSSGEIAEAQERPLS
PKPSPPFMELEPKPTTSSIKEKVKVFQMKANGEEEDRSRATGKGVRVKEETHITTTTRMV
YHSPPGSEGSSERIEETMSVHDIMKAFQSGRDPSKELAGLFEHKSAVSPDVHKSAAETPA
QHAERDSPMKPKLERIIEVHIEKGNQAEPTEVIIRETKKHPEKEMFVYQKDLSRGDINLK
DFLPEKHEAFPGSEEQGPPEEEELTAEESLPSYLESSRVNTPVSQEEDSRPSSAQLMSDD
SYKTLKLLSQHSVEYHEDELSELRGESYRFAEKMLLSEKLDVSHSDTEESATDHAVALSV
ELQGSDRRSRDKVAPKREILSKIYKDVSENGLGKVPKDEPFDKVTVLHYTGDVSSPKHAM
WMRFTEDRLDRGREKLLYEDRVDRTVKEAEEKLTEVSQFFRDKTEKLNDELQSPEKKARP
QNGKDAHSPQSSASSSPEKLPLTESLTASDDGAKARQPGRDGKGFPKAEERRAASLPSSP
ERKLLKAAEGGFQLKQSKLSSIRLKFEQSIHPKSKDVSAEERKPDGPSKIPIKKVQESKL
PLHQAYSREKPPKVAGPAEGGGSLQRELPATKREQPQNGEAAVGEAGSAEVERPRTETSS
PSVPERYAEPQPKDLAHSVSSDLATKGPWDKKIFRTWESSGATNHKAQKEKLSHVLVHDV
QENHVDRPENQGLDSKSESISVSEREHPLLTNGAHSEIKEVTVKSPSKKVLYREFVVKEG
GRTPETGDQAPQKGEGTAVSHIPVRIAEERKMLSSSAIPDGFCDQSKFPRYELSPKSPQS
SLSKETFETHQLNSVKEEKVTYSEISKISKHQSYVGLCPPLEETETSPTKSPDSLEFSPG
KESPSSDLFDHSPMDGLAKAAPLAETEGGKEIKTLPVYVSFVQVGKQYEKEVHQGNVKRI
VSQECKTVQETRGAFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEV
SYEFTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQVKSTSLKQMAAIDLEMSSPLSKDSP
KRSKGNRVAYIEFPPPPPLDADQAEPERKPPYSPEREVEMTEVSLQDEHDKYQLAEPVIR
VQPPSPVPPGADVSDSSDDESIYQPVPIKKYTFKLKDVEDDQKEASKPKSSEKAPAAKES
GSHGSRKESELDIGLDSPQNEVAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDL
QDEDDGLTESDSKLPGQTVEIKKDVWNTEGILKPSDRSFSQSKLEVIEEEEGKVGPEEEK
PLSKGSASDKSPDKTEQKSGTQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKS
LDFDPWSNNRGDDEVFETKSREDESKPFGLAVEDRSQATTPDTTPARTPTDESTPTSEPN
PFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDKGEGDKPMGTAITQ
PQSGDTTVETDLERKVEATAVEHKPAIQPGGECQEAAPSSSPPEKPPAVATASKVDPKLR
TPIKMGISASTMTMKKDGPGEGAEKVEAMLSSGQGLENEPVTVIASAASSQRDFRPKEKH
DFQKDNFNNNNNLDSSTLQTDNIANNVVLPDHSITTCTTEKANPVKSSLGALQGHCLKET
QKVPEEQKKKKESIGLRPKSKLPIKATSSRDAFPPKHVPNKAVSKGRQVSKPERAQTLNS
SPCLEIRSRIPIKNPARESLALVRESGAKPKQGQLEKGKIKPIPSKLPVKVRSACVATTA
VKVRKTQLREVCKHSIEYFKGISGETLKLVDRLSEEDKKTQPEGSDDEDSTSRNTSSSEV
ARVCPPPITPKSARDKRKEAASLKSKNGKAGSERRSSRRTGPQSPCERTDIRMAIVADHL
GLSWTELARELNFSVDEINQIRVENPNSLIAQSFMLLKKWVTRDGKNATTDALTSVLTKI
NRIDIVTLLEGPIFDYGNISGTRSFAEENNVFHDPVDGWQNETSTGSPEPPMPGRRIAGG
LLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHPEAFPESTAKPHVQESQNDIGKLRDKE
PLKPKTPGSGRSDGPVAYQKSVEESSKHLADEIKTSVPVSVKKMNRTSSGDAKPRLNLHE
EEGAVVPEHKQGEGYKVKTKKEIRPVEKKSHS
Download sequence
Identical sequences F6VKH7
ENSMODP00000021315 ENSMODP00000021315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]