SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021330 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021330
Domain Number 1 Region: 725-836
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-50
Family Thrombospondin C-terminal domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 599-723
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.48e-34
Family TSP type-3 repeat 0.00000357
Further Details:      
 
Domain Number 3 Region: 516-600
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.22e-17
Family TSP type-3 repeat 0.0000744
Further Details:      
 
Domain Number 4 Region: 226-271
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000209
Family Assembly domain of cartilage oligomeric matrix protein 0.0018
Further Details:      
 
Domain Number 5 Region: 449-541
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000798
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 6 Region: 54-153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000012
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 7 Region: 310-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000325
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021330
Domain Number - Region: 424-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000922
Family EGF-like domain of nidogen-1 0.056
Further Details:      
 
Domain Number - Region: 364-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 276-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021330   Gene: ENSMODG00000017093   Transcript: ENSMODT00000021704
Sequence length 839
Comment pep:novel chromosome:BROADO5:2:189892283:189903145:-1 gene:ENSMODG00000017093 transcript:ENSMODT00000021704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGPLALLLLCSFASASQDLQVIDLLTMGESRQMVAMAEKIRTALLTAGDVYLLS
TFRLPPKQGGVLFGLYSRRDNTRWLEASIVGKINKVLVRYQREDGKVHAVNLQQVSLADG
RTHTVLLRLRGPSRPSPSLQLYVDCKLGDQHAGLPALAPIPPAEVDGLEVRTGQKVYLRL
QGFIESMKMILGGSMARVGALSECPFQGDEESIHNAVTGVLHSILGKQTKALVTQLTLFN
QILVELREDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGYR
CGPCPPGLQGNGTHCTDINECAHADPCFPGSKCINTVPGFHCEACPQGYKGTQVSGVGID
YARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRSGFLGNQSQGCLPARACQ
SPAHNPCHVHAHCLFERNGAVSCSCNIGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCK
QDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDAC
DNCPNVANNDQKDTDSNGEGDACDNDVDGDGIPNGLDNCLKVPNPLQTDRDEDGVGDACD
SCPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGQGDEC
DGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVADPLDVCPESA
EVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEG
TFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLRVLQPI
Download sequence
Identical sequences F6V380
ENSMODP00000021330 ENSMODP00000021330 13616.ENSMODP00000021330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]