SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021332 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021332
Domain Number 1 Region: 285-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-33
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily RING/U-box 8.84e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000168
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021332   Gene: ENSMODG00000017094   Transcript: ENSMODT00000021706
Sequence length 449
Comment pep:novel chromosome:BROADO5:4:430509698:430609197:1 gene:ENSMODG00000017094 transcript:ENSMODT00000021706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
ALAPSLKLANIVERYSAFPLDAILSARRAALPCQAHEKVKLFCLTDRALVCFFCDEPALH
EQHQVTGIDDAFEELQRELKEQQKSLQDSEREHTEALQLLKRQLAETKKGWGRRKQRVVV
SSGNRQLRELGQSFLSVLELKLNKSAKSVSSGPRSMGQEGWEAREGEQLSPSGLKQKWIF
TTDPEHSPSRLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLDPVTA
HQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFGSGVHYWEVVVSEKTQWM
IGLAHEAVSRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVKNKLEKMRSEKLRVR
ISPTMFTKYSKKKNFTSPVNFSEPQFAPL
Download sequence
Identical sequences F6V365
ENSMODP00000021332 ENSMODP00000021332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]