SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021342 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021342
Domain Number 1 Region: 337-461
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000159
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021342
Domain Number - Region: 71-123
Classification Level Classification E-value
Superfamily HR1 repeat 0.0942
Family HR1 repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021342   Gene: ENSMODG00000017104   Transcript: ENSMODT00000021716
Sequence length 591
Comment pep:novel chromosome:BROADO5:1:35400625:35468799:1 gene:ENSMODG00000017104 transcript:ENSMODT00000021716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLAETLERLRGRVVAGARARVRSGSRSRSRSGSGSGAEAGAQAVQPRLRAGQSPDGLA
GGLAQQPDGSIGGKLGFEMRMREGICKLLSLSTQKDQILEAVKNLMVCNARIMAYTEELQ
KLEDPAIREATERRCRNEAEARKACKGKVALSDVRIPLMWKDSDHFSNKEGSQRYAVFCL
FKMGAEIFDTDMVIVDKTVTDLCFENVTIFNEAGPDFQVKLEVYSCCADESCLTNTSRIF
AKKLRSSFSKATAKKFNCMQRENDLDAGFHISPERLGVKYNLLAHTTLTLEHTEDSFKTH
TLTITGNEESSFWLPLYGNMCCRLAAQPACMTEDAFKGYLNQQQKVCNIILWRRLYCVLR
GSQLLCYCCAEEIEAKMEPTLVVPINKDTRVSVVPKKASHFSIVNIEAGLGVTEVFVADD
SEEFHAWMGAFSQHFLSFSQWKHCCEELMKIEIMSPRKPPLFLTKEATSVYHDMSIDSPV
KMENLTDVKKKKIEDTKGQLLNSLERPLSPWAKVFDGTHQMAIHKTVVVLPENKQLNSND
GKVKKRRAPLPPSDKPLCSVKGQMDKENLWEETSFVSRTSSSNASSLMHQL
Download sequence
Identical sequences F6UKG0
ENSMODP00000021342 ENSMODP00000021342 XP_007478334.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]