SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021403 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021403
Domain Number 1 Region: 317-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-69
Family SPRY domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-18
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 
Domain Number 3 Region: 150-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000306
Family C1 set domains (antibody constant domain-like) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021403   Gene: ENSMODG00000017153   Transcript: ENSMODT00000021778
Sequence length 564
Comment pep:novel chromosome:BROADO5:4:429326352:429342882:1 gene:ENSMODG00000017153 transcript:ENSMODT00000021778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCSSFLLYSYLIIFLSLQLPTEGSGKIGKRNLVLLGTKAELRCPLSLWMVPESIEVKW
LRTQKSSSAQTVHVYRNGQDFYGEQMPQYKGRTALVRDNQEDNFILEIYNVQLEDQGQYY
CQIQAGILSKNATVKLEVAALGLDPYIHMKSYEDGQIQLVCRSLGWFPKPQIQWRDTHGE
ILPSETQYLEKEGLFQMETSISLRNVSPGNMTCSIWNAALDQEKKTTLFIAAFSHLHVAP
STVGLVVILPILGLLIALGIYIIWKQRRAREKLLYQQVVEIENLLSDHGKEKGRLHKGLK
KHRAELKLKRSAANAGWRRAKLHPVDVTLDPDTAHPKLLLSEDLRSVRLGDKRQDVPDSP
KRFDFVVSVLGSPSFTSGCHYWEVCVADKTKWILGVCSEAVTRKGKITASPSNGHWLLRQ
SRMNEYEALTSPQTCFHLKESPRRVGIFLDYEAGLVSFYNATNKSHIYTFTHAFSGPLRP
FFEPCLHDEGKNVAPLIICSASQSSEEFLDSNLSPETPQNEKQISGIGNGSIPLKSNLYP
LQDIISSWPSDVPPALQGLRAPSF
Download sequence
Identical sequences F6QE42
XP_007493017.1.35504 XP_007493018.1.35504 XP_007493019.1.35504 XP_007493020.1.35504 ENSMODP00000021403 ENSMODP00000021403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]