SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021414 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000021414
Domain Number - Region: 377-459
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021414   Gene: ENSMODG00000017162   Transcript: ENSMODT00000021789
Sequence length 526
Comment pep:novel chromosome:BROADO5:7:22854593:22901405:-1 gene:ENSMODG00000017162 transcript:ENSMODT00000021789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRVEGVARGRGGGEESTDPGRGGRRRSPRQKFIIGTMEEAGICGIGVKSDDMLSSTQR
NDILQHQASNCHGSNSKKSLEEVEKSNFLTKNRNLVSTAYCTRESREETPGREARTDPPD
GQQDTESDKNKEKTLGKEVLLLMQALNTLSTPEEKLAALCKKYADLLEESRNVQKQMKIL
QKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAREEEERRKEA
TAHFQITLNEIQAQLEQHDIHNAKLRQENIELGEKLKKLIEQYALREEHIDKVFKHKELQ
QQLVDAKLQQTTQLIKEAEEKHQREREFLLKEATESRHKCEQMKQQEAQLKQQLSLYMDK
FEEFQTTMAKSNELFTTFRQEMEKMTKKIKKLEKETIVWRTKWENNNKALLQMAEEKTVR
DKEYKAFQIKLERLEKLCRALQTERNELNEKVEVLKEQVSVKGADVDQTVPVLQSCTLLD
SHKKLKTPSKKEMEIPLEVEHNAIDEGDGSQETVSMSSVPDTDSVD
Download sequence
Identical sequences F6QDN1
13616.ENSMODP00000021414 ENSMODP00000021414 XP_007500915.1.35504 ENSMODP00000021414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]