SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021430 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021430
Domain Number 1 Region: 1-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.98e-114
Family Nitrogenase iron protein-like 0.000000000903
Further Details:      
 
Domain Number 2 Region: 310-559
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.5e-69
Family Class I glutamine amidotransferases (GAT) 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021430   Gene: ENSMODG00000017176   Transcript: ENSMODT00000021805
Sequence length 597
Comment pep:novel chromosome:BROADO5:7:22966350:23100223:1 gene:ENSMODG00000017176 transcript:ENSMODT00000021805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFV
LNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERHGDYLGKTVQVVPHITDA
VQEWVMNQAKIPVDGHKEEPQICVIEASMGRISLGGTIGDIEGMPFVEAFRQFQFKAKRE
NFCNIHVSLLLKFLFQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSKPIEMAVKEK
ISMFCHVEPEQVIFIHDVSSTYRVPVLLEDQGIVKYFKERLDLPIDDHASDLLFKWKNMA
DRYERLQKTCSIALVGKYTKLSDCYASVFKALEHSALAINHKLDLMYVDSIDLEQSSEVE
NPVRFHEAWQKLCKADGILVPGGFGYRGTEGKLRAISWARTKKIPFLGICLGMQLAVVEF
ARNCLNWKDADSTEFVPNTSIPVVIDMPEHHPGEMGGTMRLGKRTTVFKTEDSILRKLYG
DVGCVEERHRHRYEVNPELIQQFEEKGLKFVGRDIEGERMEIIELANHPYFVAVQFHPEF
SSRPMKPSPPYLGLLLAATGTLNAYLQQGCKLSSSDSYSDLSDDSFPERKSPEIVTN
Download sequence
Identical sequences K7E4X2
ENSMODP00000040824 13616.ENSMODP00000021430 ENSMODP00000021430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]