SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021444 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021444
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000549
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021444   Gene: ENSMODG00000017189   Transcript: ENSMODT00000021820
Sequence length 118
Comment pep:novel chromosome:BROADO5:1:470549349:470550868:-1 gene:ENSMODG00000017189 transcript:ENSMODT00000021820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGAALQNYNNELVKCIEELCQKREELCRQIQQEEDEKQRLQNEVRQLTEKLARVNEN
LARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLGKAPVQDQKSMGKDS
Download sequence
Identical sequences F6XXQ9
XP_001367182.1.35504 13616.ENSMODP00000021444 ENSMODP00000021444 ENSMODP00000021444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]