SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021539 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021539
Domain Number 1 Region: 41-376
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-111
Family Putative alpha-L-fucosidase, catalytic domain 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021539   Gene: ENSMODG00000017260   Transcript: ENSMODT00000021915
Sequence length 475
Comment pep:novel chromosome:BROADO5:2:421584378:421597958:-1 gene:ENSMODG00000017260 transcript:ENSMODT00000021915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSQSSGQPLVPARGSALLLLSLLLLLSQLLPGCSAQTKRYEPTWDSLDARELPAWFDE
AKFGIFIHWGVFSVPGFGSEWFWWYWREQKIPAFVDFMKANYPPDFKYEDFALEFKGTFF
KAYQWADIFQASGAKYIVLTTKHHEGFNLWKSNNSWNWNSVDRGPRRDIVKEIEVAIRSK
TDLHFGLYYSLFEWFNPLFLLDKANKFKSKRYPVAKSLPDLYDLVNTYKPEILWADGDGD
APDTYWNSTDFLAWLYNESPVRDTVVTNDRWGLDNICRHGGYYTCSDRYNPGHLLPHKWE
NCMTIDKESWSYRRNAPLSDYLTIEEIVSQLVETVSCGGNFLMNIGPNKDGVISPIYEER
LRQTGAWMKVNGEAIYETKPWRAQNDTLTPRVWYTSKPKENLVYAIFLQWPSSRMLVLGE
PKATSGATTVKLLGYQDPLKWITVPNRGIIVELPELTLDALPCKWGWSLELRNVQ
Download sequence
Identical sequences F6TJX9
XP_007484717.1.35504 ENSMODP00000021539 ENSMODP00000021539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]