SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021622 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021622
Domain Number 1 Region: 399-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-26
Family MAM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 82-210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 218-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000242
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021622   Gene: ENSMODG00000017323   Transcript: ENSMODT00000021998
Sequence length 543
Comment pep:novel chromosome:BROADO5:7:27359215:27553029:-1 gene:ENSMODG00000017323 transcript:ENSMODT00000021998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASWCPGLSLLLSFVAGGFVNSAASSRSHRPLAFADQPGVCHYGPKSECCYGWRKNSKG
FCEAICDHGCKYGECVGPNNCKCFPGFTGKTCSQDMNECGLKPRPCKHRCMNTHGSYKCY
CLSGYMLMPDGTCSNSRTCAMTNCQYGCEDTKDEVRCLCPSAGLQLGPNGRACIDVDECT
SGKALCPYNRRCVNTFGSYYCKCHNGFELKYINGRYDCVDINECMANTHKCNIHADCLNT
QGAFKCKCRQGYKGNGFHCSVIPENSVKEISQTPGTIKDTIKKLLAHKSSVKKNEEIKNV
IPEPAGTPATKVLLQSFHYEDGIQVGRAYDRKVKEHGDTRREDEPEEGQLDFRNQIDPEH
SLRGDVFFSKVNEEVPFDLFLVQRKVPTSKLEPKDLNVSVDCSFDQGICDWKQDSEDDFD
WNPADRDNAVGYYMVVPAFAGHKKDVGRLKLLLTNLQPQSSSCLMFDYRLAGERVGTLRV
FLKEKNNTLAWEENSNEDGRWRTGKIQLYQGIETTKNIIFEAERGKGKTGEIGVDTVLLV
SGF
Download sequence
Identical sequences F6WWJ4
ENSMODP00000021622 ENSMODP00000021622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]