SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021636 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021636
Domain Number 1 Region: 634-789
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.07e-36
Family MAM domain 0.0015
Further Details:      
 
Domain Number 2 Region: 951-1117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-29
Family MAM domain 0.0046
Further Details:      
 
Domain Number 3 Region: 792-949
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-28
Family MAM domain 0.00069
Further Details:      
 
Domain Number 4 Region: 34-192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-28
Family MAM domain 0.01
Further Details:      
 
Domain Number 5 Region: 243-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-18
Family MAM domain 0.0089
Further Details:      
 
Domain Number 6 Region: 479-623
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-16
Family MAM domain 0.012
Further Details:      
 
Domain Number 7 Region: 197-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 8 Region: 433-469
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021636   Gene: ENSMODG00000017335   Transcript: ENSMODT00000022013
Sequence length 1198
Comment pep:novel chromosome:BROADO5:1:468997556:469013541:1 gene:ENSMODG00000017335 transcript:ENSMODT00000022013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPRKTTCNFVCDFWDCFDESHCGYHKESPALGAPFACDFEEDSCGWQDISTSGYRWLRDR
AGSAFRNPEPHTDHTFGTDLGWYMAVGTHQGKEPATATLRSPVLHEAAPTCEIRLWYHGN
IQDVADLRMELTHNSETLILWQSIGQLGGSNWQELVVATGRIQGDFWVTISATRNATHRG
AMALDDVEFWNCGLPSPQNSCTRYQHHCDNYACVELTELCDGEDNCGDASDEDKDSCIDY
KVTDFENGLNHWTNTTGWVITRGSEASVASAEPVRDHSKNSASGSFLLSKAEQENPAILV
SPEFYPSSTNNCLFTFYYYLHGSEDGNLQLFLQSLDPDSPQTELIRTRHGELGTAWVRDR
VDIYKKHPFRILLKGHTGPGGVVGLDDLILNQHCKPANNASPPEASPLGPLAALPLHLQH
LTKTGSRLQRDSFCEPGHFSCGDFCLPPEQLCDFVPQCEGGVDEQNCGKEWVLSNQALGG
WEDASVGLQWKRLNVQENSDPKTDATGNETGHFLSVKRAWGQLTGMARARTPVLGPSGPS
CTLKMAYYLQGQPEGFLALRVVEDGVHELAWKIQGNSNDTWRWVTVPLGERERPFQLELL
GKMDLKVPGTKGVGVDEITFVNCDPTVTTEKDTELSCNFERDSCGWYPEHKTDALWQRAS
RPGPGYDHTTSQGHFMYLDPTMPPARGRGARLLTALQVPPTHNECLSFWYHLYGPQIGTL
SLTLKRAGEPDRHLWARTGTHGNKWHQAWATLAHPPDPITKYQLVFEAHRNGYHGNIAVD
DITVRPGSCWAPRHCSFENSACGFLSSGQGTWQWQGNATDSVIRGPRADHTTETSEGHYM
MVDTSPSALPQGQRAVLTSEEYSPLAQPGCFTFWYHLSLRNPGTLHVYVEEDKRRRIFSV
SAHGGFTWRLGSVDVQPEKAWKVIFEAIGAGVEHTYIAVDDLHLKDGPCPQPGSCDFESD
MCSWSHTPWPGLGGYSWDWSSGATPSRYPQPPVDHTLGTNTGHFAFFDTSVLGPGGRAAW
LRSEPLPPTPVGGSCLQFWYHMGFPEHFYKGELKVLLLSSQGLLTLWGTGAYLRHQWLEG
YVHVTSPVEFQIVFEATLGSQPVLGPIALDDIVYQTGQSCEPLVPNQEESSKPLTIPVVM
ITFLVALILGLLAFGVWHRLKKGGYPFKREKENNTASGFDNVVFNSDHVTLPSITSDQ
Download sequence
Identical sequences F6WVQ2
ENSMODP00000021636 ENSMODP00000021636 13616.ENSMODP00000021636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]