SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021648 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021648
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-123
Family Nitrogenase iron protein-like 0.000000000122
Further Details:      
 
Domain Number 2 Region: 300-546
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 9.32e-67
Family Class I glutamine amidotransferases (GAT) 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021648   Gene: ENSMODG00000017346   Transcript: ENSMODT00000022025
Sequence length 591
Comment pep:novel chromosome:BROADO5:4:427087081:427128418:1 gene:ENSMODG00000017346 transcript:ENSMODT00000022025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYILVTGGVISGIGKGIIASSIGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFV
LDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDA
IQEWVMRQALIPVDEDGIEPQVCVIELGGTVGDIESMHFIEAFRQFQFKVKRENFCNIHV
SLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQ
VICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS
IALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPSTLQEEPVRYHEAWQK
LCSANGVLVPGGFGVRGTEGKIQAISWARKQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN
STEFDPKTSHPVVIDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDPDYLEERHRH
RFEVNPVLKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPY
FGLLLASAGRLTHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Download sequence
Identical sequences F6WFF7
ENSMODP00000021648 ENSMODP00000021648 XP_001366956.1.35504 XP_007492976.1.35504 XP_016278019.1.35504 XP_016278020.1.35504 XP_016278021.1.35504 XP_016278022.1.35504 XP_016278023.1.35504 13616.ENSMODP00000021648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]