SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021705 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021705
Domain Number 1 Region: 210-347
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-18
Family Cadherin 0.0026
Further Details:      
 
Domain Number 2 Region: 443-543
Classification Level Classification E-value
Superfamily Cadherin-like 5.76e-18
Family Cadherin 0.0041
Further Details:      
 
Domain Number 3 Region: 320-453
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000003
Family Cadherin 0.0038
Further Details:      
 
Domain Number 4 Region: 539-643
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000214
Family Cadherin 0.0055
Further Details:      
 
Domain Number 5 Region: 124-222
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000022
Family Cadherin 0.0061
Further Details:      
 
Domain Number 6 Region: 12-110
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000671
Family Cadherin 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021705
Domain Number - Region: 629-683
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00353
Family Pseudouridine synthase RsuA N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021705   Gene: ENSMODG00000017389   Transcript: ENSMODT00000022083
Sequence length 876
Comment pep:novel chromosome:BROADO5:8:157333765:157425143:1 gene:ENSMODG00000017389 transcript:ENSMODT00000022083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGDCLQLKEFPASCFVPENTSPGTRIYNFSVTLSPLASSVSSGFPLIINSSPLTRAFSIN
GLSGKNFEVVTTGQPPLDFETMPKSFDLQIYVKDEAGAMDLGLLTVKLKDVNEPPMFLDN
LAKETVELYILEGTSPGPIYQIEVVDPEDRAIKEPLLFSLIYPLEYFRVSTNGVLFSTTT
FDFEAGNNSYVIEVEIQDSRELKATRTFLVNIINVNDESPYFTSSIRVYRIPEELSPGTI
VANVTAKDPDDEDFMGRLLYQLTTHNEHFIINQLTGSIQIASRINRDAGKLKHNPNILLE
ILVKDRPKGGQENRTQITFIIEDINDNPSTCNQFTFSISVPEKTIKGMLLLNLVQHCFDN
DAEAPNNQFNFTDLSGVRSNGKFSQDPDGSGKILLIGDLDYEDLNNLAAGNKYVLSIQVQ
DIVSPYFKSTIYIYIQTIPENEFPLVFDSPSYFEVSEMKPVQSRIGQVHATDEDYPKSNI
TYSILSGGSTVQYTGLFWINPKTGVLQLMTKADFESAPLHILTVRAANREDTSTATVTVK
ILDENDEKPTCEPNFYFLTIPVDLRVGTNIQNFKLMCADKDSSPRSFRYSIGQGNKNNHF
TFSPNAGSNVTSLLLATPFDYSSGFDKDWNYKLLVYITDDNLLTSRKKAEAFIETGTVTL
NIEVIPPPTTVITTTSMPRVTYLIQRENVYSSSAWYVPFVITVGSMLLSVLLGYQFFLLV
KFIRRHCSFKPKEDKGFLVKKGETKKAKREVVLEMTKINTVFDGEALDPVTGKIYEFNSK
SGARKWKNPSIQLQSGEKDLREQVAIWTVADGEGMKPLERINKEVDGKNEQMEADDIHVG
LKSEEGKVETSQSLGTPKGSSPILIGRASPKIHPLS
Download sequence
Identical sequences F6SL45
ENSMODP00000021705 13616.ENSMODP00000021705 ENSMODP00000021705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]