SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021805 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021805
Domain Number 1 Region: 575-695
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-32
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 477-579
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-30
Family Cadherin 0.00068
Further Details:      
 
Domain Number 3 Region: 254-377
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-30
Family Cadherin 0.00081
Further Details:      
 
Domain Number 4 Region: 133-258
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-20
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 678-790
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-16
Family Cadherin 0.013
Further Details:      
 
Domain Number 6 Region: 365-475
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021805
Domain Number - Region: 28-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.0157
Family Cadherin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021805   Gene: ENSMODG00000017473   Transcript: ENSMODT00000022184
Sequence length 1308
Comment pep:novel chromosome:BROADO5:X:63188355:63717438:1 gene:ENSMODG00000017473 transcript:ENSMODT00000022184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFYSGICILTVLMAFFIFQSDAQEKNYTVPEELPENVLIGDLVKDLNLTFSPDKKLSTP
LQFKLVYKSGDLPIVKIEETTGEIYTTGVRIDREELCTGIYIETHCFYEVEVAVLPDEIF
KLVKIRFIIEDVNDNAPLFPATVINISIPENTAINSRYPIPSAIDPDIGINGIQQYELIK
SVVPGFNVGTNITKYLEELDIFGLDVIETPEGEKWPQLIVQKMLDREERDTYVMKLKVED
GGSPPRSSTAILQVSVIDMNDNRPIFKETEIEVTIPENAPVGSSVYQLHATDADVGANAR
IQYFFSSLMSNVAKKLFSLNNTTGLITIKEPLDREQAPLHKLMIVATDGGPMPARAMVIV
NVTDVNDNLPLIDVRYIIDTTNGTVFLSENAALNTKIALVTLIDKDADRNGRVTCFTTNE
VPFRLRPVFDNQFLMETSSFLDYETVKEYEVQLLASDAGKPPLNYTTSVVIKIKDENDNA
PVFTQPTFGISVPENNALGAQLTKISATDKDSGKNGEITYLIANEGPYPFSLDNRTGVLS
AVEQLDRETKDKYTFTVTARDNGEPHLQSNATVTVTVLDQNDNSPTFTHSEYNFYVPENL
PKHGTVGLITITDPDTGDNGVITLTILNNNGSFIIDAVNGVIRPNISFDREKQESYTFVV
VATDGGRVPRSSTARVTINVVDINDNKPVFVVPPSNYTFEFIPLATEIGTLLYVVMAVDE
DTGMNSEIRYQIEDGNKKKLFEMEGSSGNITLKSKFIPADTGLHKLLIKARDLGQPDSMN
SKILVNLFVNDSLHNSSFVDELLRRARGKTRNREVEKTDVANTINSDYIKYIIAIISGSM
TAVLTIVIAAILRCRHFPGFKARKQNSEWVTPNPANSETITLTTTDIGGANSVIVNLVSL
SEPRTDDAENEEEVTTSIDVAVDIEEATMEKYNWGTNSSTFKPDGPDLAQHYKATSPQPA
FHIEPETPVHSKHHVIQELPLDNTFVMGCDSLSKCSSSSSDPYSISDCSCQGTIKTTATI
HPRQAANELGMTDIPLNDPNVIAIRTYPLHLMPAARPRTPLREPAVQETVVDIWGPPQRK
PEPKKPGKAQRRVTFHLPESSQESGSDNAPIDVEAGAVGGARPFGYGRRDYYDHATHSNR
TEGDGNSDPETAAEVTVQPTLEEASDNCTQECFILGHSDSCWMPAALPQYQQPRSPEPPA
VIRHSPPASNLITTTVLCHNPPQPQAAAICPSPPQAQRLELGHGARPEERGATGGLFAQD
DSIQGRRSGPRGLFCTAEHDNSIKVIPMMTFPPGRARREFPKVDENPM
Download sequence
Identical sequences K7DZY1
ENSMODP00000039082 ENSMODP00000021805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]