SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021908 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021908
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-19
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021908   Gene: ENSMODG00000017562   Transcript: ENSMODT00000022292
Sequence length 532
Comment pep:novel chromosome:BROADO5:1:465528224:465551819:1 gene:ENSMODG00000017562 transcript:ENSMODT00000022292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDYENDEECWNMLEGFRVKLISIIDPSRITPYLRQCKVINLDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKITGKEPTRVFSMIIDASGESGLTQLLM
NEVMKLQKKVQDLNVMLSAKDDFIKEMRVKDSMLRKHQERVQKMKDECEAFSHELKRCKD
ENYDLAMLYARQSEEKNMALMRNRDLQLEIDRLRHNLMKAEDDCNVERKHTMKLRHAMEQ
RPSQEVVWEIQQEKDLLQAKIQELESSIREGRRDKNNAYIQVLEEDWREALKDHQEKENT
IFHLRKELRQAEALRNKSIEEKEMFELQGMALRKDSKMYKERIEAILQQMEEVAIERDQA
IMTREEFHLQYSNSLKEKDELRKQIRELGEKCDELQLQLFKKEGELLFMESKLKRLQLET
PILVCLLFISFPKLTLPRDLEEDAQLSNKTSPCGGSCPDLPHSPDYHLILFSFQGSRLSN
GDHQEKERRRIKESFENYRRKWAHRKVHHSTRQGEVDWENTTGSDNTDTEGS
Download sequence
Identical sequences F7BSP6
ENSMODP00000021909 ENSMODP00000021908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]