SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021946 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021946
Domain Number 1 Region: 1869-2113
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.36e-54
Family Ankyrin repeat 0.000000058
Further Details:      
 
Domain Number 2 Region: 452-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000914
Family EGF-type module 0.00055
Further Details:      
 
Domain Number 3 Region: 857-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000001
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 1170-1312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000155
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 408-533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000108
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000014
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 986-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 8 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000454
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000933
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 10 Region: 528-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000121
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 11 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 12 Region: 141-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000328
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 205-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000926
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 14 Region: 1141-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000127
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 15 Region: 562-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 16 Region: 832-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000113
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 1389-1427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000495
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1528-1560
Classification Level Classification E-value
Superfamily Notch domain 0.000000109
Family Notch domain 0.0037
Further Details:      
 
Domain Number 20 Region: 1488-1521
Classification Level Classification E-value
Superfamily Notch domain 0.000000119
Family Notch domain 0.0044
Further Details:      
 
Domain Number 21 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 22 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000524
Family EGF-type module 0.016
Further Details:      
 
Domain Number 23 Region: 1108-1149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000967
Family EGF-type module 0.025
Further Details:      
 
Domain Number 24 Region: 1447-1479
Classification Level Classification E-value
Superfamily Notch domain 0.00000103
Family Notch domain 0.00035
Further Details:      
 
Domain Number 25 Region: 61-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000466
Family EGF-type module 0.011
Further Details:      
 
Domain Number 26 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000504
Family EGF-type module 0.057
Further Details:      
 
Domain Number 27 Region: 1348-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021946
Domain Number - Region: 26-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000231
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021946   Gene: ENSMODG00000017591   Transcript: ENSMODT00000022332
Sequence length 2485
Comment pep:novel chromosome:BROADO5:1:465164951:465241340:1 gene:ENSMODG00000017591 transcript:ENSMODT00000022332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLLVPVVCLSLLPVLARGFRCSQPSETCLNGGKCEIHDNGTESCICSGAYVGERCQAP
NPCLSSPCKNAGTCHTVIRGSIVDYTCTCRLGFSDRLCLTPEDNACLNNPCRNGGTCILN
TLTDFKCRCPPGWSGKTCQQADPCASNPCANGGNCVPFESSYICVCKNGFHGPTCKQDIN
ECTNTPGICKNEGTCHNEVGSYRCVCTSAYTGQNCEQLYVPCNPSPCQNGGTCRQTGDTT
YECTCLPGFTGQNCEDNIDDCPGNNCKNGGTCVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGDYNCVCVNGWTGEDCSENIDDCANAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYMGPACNQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGNCIDKISEFHCECPTGFNGHLCQYDIDECASTPCKNG
AKCVDGPNTYTCECTEGFTGSHCEVDINECDPDPCHYGTCKDGIAAFTCRCQPGYTGHRC
ETNINECQSQPCRNGGTCQDRHNAYYCLCLKGTTGPNCEINLDDCASNPCDSGKCIDKIN
GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINSFTCHCPDGYHDPTCLSEVNEC
SSNPCIHGKCRDGLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEEVLAPCAKDPCKN
GGECKESEDYESFSCMCPTGWQGQTCEIDINECVKSPCRNGATCQNTNGSYRCSCRAGYM
GRNCETDVDDCQPNPCHNGGACSDGINAAFCDCLPGFRGPQCEEDINECASNPCKNGANC
TDCVNSYTCTCPSGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCLCPPGFTGSYCQH
DINECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNNL
YRCECNSGWTGLYCDVPSVSCEVAAKQQDTDVAHLCRNSGLCMDTGNTHYCRCQAGYTGS
YCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCQNGGTCID
LINTYKCSCPRGTQGVHCEINVDDCNPFIDPLTRGPKCFNNGKCVDQVGGYSCNCPPGFV
GERCEGDVNECLSNPCDPHGTQNCVQRVNDYKCECRQGYTGRRCDSVIDGCKGKPCKNGG
TCAVATNTGRGFICNCPSGFEGATCENDSRTCGSLHCMNGGTCVSGQKSSKCLCLGPFTG
PECQYPVSSPCISNPCYNQGTCEFIPESPFYQCHCPANFNGLLCHILDYGFLGGVGRDIT
PPEFEEKCEIPECRKDTGNKICDGKCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFN
DGSCDSQCNNAGCLFDGFDCQKVEVQCNPLYDQYCKDHFSDGHCDQGCNNAECEWDGLDC
AHMPEKLADGTLVVVVLMLPDNMRRYSSHFLRELSRVLHTNVVFKKNAKGEYMIFPYYGN
AEELKKHHIKRSAESWADMPGTVFNKVKTSLYSRVGGRQRRELDQMDIRGSIVYLEIDNR
QCIQSSSQCFQSATDVAAFLGALASMGNLNIPYKIEAVQSETVDSPEPSQLYPMYVVVAA
LVLLAFIGFGVLVSRKRRREHGQLWFPEGFKVTESSKKKRREPLGEDSVGLKPLKNASDG
ALMDDNQNEWGDDDLETKKFRFEEQVTLPDMDDQTDHRQWTQQHLDAADLRISSMAPTPP
QGEIDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQ
TDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRN
RATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDA
AVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQE
RMHHDIVRLLDEYNLVRSPPLHNGSLGAPTLSPPLCSPNSYIGNLKPAVQGKKARKPSTK
GLGCNGKDAKDIKARRKKSQDGKGCLLDSSSVLSPVDSLESPHGYLSDVASPPLMTSPFQ
QSPSMPLNHLPGMPDAHLSINHLNMAGKQEMAALGSASRLGFDAVPPRLSHLPVASSPSA
VMSSGSMNFAVGGAASLNGQCEWLSRLQNGMVQNQYNPLRGNIPAGPLNPPPQSLQHNIL
GPLHNGLSTTTLSTTTGHIGQSFLGSELNQQDVQQLGSSSMAVHTILPQETQILPTTLPS
SLSQPMTTTQFLTPPSQHSYSSPMDNTPSHQLQVPDHPFLTPSPESPDQWSSSSPHSNIS
DWSEGISSPPTSMQSQIAHIPDAFK
Download sequence
Identical sequences F7B4M7
ENSMODP00000021946 ENSMODP00000021946 13616.ENSMODP00000021946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]