SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021949 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021949
Domain Number 1 Region: 114-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000122
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021949
Domain Number - Region: 82-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000273
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 49-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000884
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021949   Gene: ENSMODG00000017599   Transcript: ENSMODT00000022335
Sequence length 145
Comment pep:novel chromosome:BROADO5:Un:35547523:35564562:1 gene:ENSMODG00000017599 transcript:ENSMODT00000022335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVQVGFPCLGKQDGVAAFEVTVIVMNSEGNIILQTPQNAIFFKTCQQAECPGGCRNGGFC
NERRICKCTDGFYGPHCEKALCTPRCMNGGLCVTPGLCICPPGFYGVNCEKVNCSTTCFN
GGTCFYLGKCVCPPGLEGDQCEISE
Download sequence
Identical sequences H9H740
ENSMODP00000021949 13616.ENSMODP00000021949 ENSMODP00000021949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]