SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022011 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022011
Domain Number 1 Region: 2782-2947
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.26e-37
Family Laminin G-like module 0.000000144
Further Details:      
 
Domain Number 2 Region: 2951-3132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-34
Family Laminin G-like module 0.0000000556
Further Details:      
 
Domain Number 3 Region: 2343-2530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.6e-30
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 2532-2717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-25
Family Laminin G-like module 0.03
Further Details:      
 
Domain Number 5 Region: 2157-2334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-23
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 6 Region: 870-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.0019
Further Details:      
 
Domain Number 7 Region: 820-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 762-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.0034
Further Details:      
 
Domain Number 9 Region: 1425-1476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 292-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 11 Region: 923-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 12 Region: 1482-1534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1065-1113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 14 Region: 972-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 419-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.063
Further Details:      
 
Domain Number 16 Region: 1532-1573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 17 Region: 1019-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 18 Region: 94-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000153
Family APC10-like 0.055
Further Details:      
 
Domain Number 19 Region: 349-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022011
Domain Number - Region: 1897-2119
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00016
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0069
Further Details:      
 
Domain Number - Region: 1383-1412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000446
Family Laminin-type module 0.083
Further Details:      
 
Domain Number - Region: 1722-1740,1768-1962
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000497
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 489-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000642
Family Laminin-type module 0.013
Further Details:      
 
Domain Number - Region: 1123-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 726-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0254
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022011   Gene: ENSMODG00000017651   Transcript: ENSMODT00000022398
Sequence length 3135
Comment pep:novel chromosome:BROADO5:2:401788685:402716704:1 gene:ENSMODG00000017651 transcript:ENSMODT00000022398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGQAWHFLLLLITGLGCPKNNRAQQQQKRALSHLQQTHQQRGLFPAVLNLATNALITTN
ATCGERGPEMYCKLVEHVPGQPVRNPQCRTCNQNSSFAYQRHPITNAIDGKNTWWQSPSI
KNGIEYHYVTITLDLQQVFQIAYVIVKASNSPRPGNWILERSLDGVEYKPWQYHAITDTE
CLTRYGIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEF
TSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARA
CPLDPSTNKSRCECEHNTCGDSCDQCCPGFHQKPWKAGTFLTKTECEACNCHGKAEECYY
DENVASRNLSLNIHGKYIGGGVCINCTQNTTGINCETCIDGFFRPKGVSPNYPSPCQPCY
CDPIGSIHEVCVKDENHARRGLFPGSCHCKHGFEGVRCDRCARGYTGYPDCVQCNCSGAG
STNHDPCIGTCNCKENVEGRDCSHCKVGFFNLQENNHKGCEECFCSGVSDRCQSSRWTYS
NINDMNGWYVTDVSGLLRVAPHHDNSDQSQQLSINSKDAKRKLPQIYYWSAPGPYLGNKV
TAAGGQLKFTISYDLTGEEDDLENVLQFMVILEGNGLQISTPQEEIYLSPSEEYRHVVLL
HSELFNVHGTGAQVSRKEFMTVLANLKRLLIQATYVFGMDAIFRLEAVGLESAVPYPTDG
DLAEAVEFCQCPAGYSGSSCESCWPGHRRVNGTIFGGICEPCQCFGHAEVCDDITGECMG
CKDNTGGPYCDRCLPGFYGDPSKGTADDCQPCACPLNIPSNNFSPTCHLDWSRGLICDEC
PVGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTG
RYCERCADGYFGDAIDAKNCQPCRCNINGSFSEICHTKTGQCECRLNVQGLRCDECQPQT
FGLQSSQGCVPCNCNSFGSKSFDCEESGQCWCQPGVAGKKCDRCAHGYFKFQEGGCTPCE
CAHLGNNCDPNTGQCICPPNTIGEKCDKCAPNSWGHSIITGCKACNCSLVGSFDFQCNAN
TGQCSCHPEFSGTKCTECNLGHWNYPHCNLCDCFLAGTDVSTCNSETEKCACLNHNGQCT
CKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCTEARGLIRMWVTLTPEQTIL
PLVDEALQHTTTKGIVFQHPEIVADMELVGEDLHLEPFYWKLPEQFEGKKLMAYGGKLKY
TIYFEAREETGFSTYNPQVIIRGGTPARARIISQHMAAPLIGQLTRHEIEMTENEWKYYG
DDPRTSRMVTREDFLDVLYDIHYILIKATYGNIIRQSRISEIAMEVAEEGAVSALSSRAR
LIEKCDCPLGYSGLSCEACMPGFYRLPSEPGGRIPGPSLGTCVPCQCNGHSDTCDAETSI
CQNCQHHTAGDFCERCALGYYGTVKGLPNDCRQCACPLITSSNNFSPSCIAEGLDDYRCT
ACPRGYEGQYCERCAFGYTGSPSSPGGSCQECECDPYGSLPVPCDPVTGHCTCRPGATGQ
KCDGCKPGHARDGMECVFCGDECTGLLLGDLARLEQMAVSINLTGPLPAPYKMLYNFENV
TQELKHSLSPQRAPERLLQLAESNLNTLVTEMDELLTRATKVTADGEQTGQDAERTNMRA
KMLSGIVKEIVQDAEAVNEKAIKLNETLGAQDKALEKSFQELQQEIDQMMAELRQKNLDM
QNEVAQDELVAAEALLRKVKKLFGESRGKNEELEKEVRDKLMDYQSKIDDAQDLLKEATD
KIKEADRLSETNQKNMTDLEKKRQAVESGKQEAENTLKEGNDILDEANHLVDEINSVIDF
VKDIQEKLPQESEELKNKIDDLSQEIKDRRLPEKVLQAEDHAARLNESSAVLDGILEEAK
NISFNATAAFKAYSNIKDYIDEAERVAKEAKGHANEATQLASGPRGSLKDDAKGSLQKSF
RVLNEAKRLANDVKENDDNLKGLKSRLENANEKNGDLLKGLNDTLGKLSAIPSDTATKLQ
AVKDKARQANDTAKDVLAQIKDLNQNLAGLRNNYNKLADDVAKTNAVVKDPAKNSKLFAD
ADATVKNLEEEADRLIDKLKPIKELQDNLKKNISEIKELINQARKQANSIKVSVSSGGDC
IRTYRPEIKKGSYNNIIVNVKTAVADNLLFYLGSAKFTDFLAIEMRKGKVSFLWDVGSGV
GRVEYPDLTIDDSYWYRIEASRTGRNGTISVRALDGPKASIIPITYNSISPPGYTILDVD
ANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWNFRDIEGDCKGCTVSPQV
EDTEGTIQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELT
DGHIKVSYDLGSGIASVISNQNHNDGKWKSFTLSRIQKQANVSIIDIETNQEENIATASS
GNNFGLDLKADDKIYFGGLPTLRNLSYFDRPEVNLKKYAGCLKDIEISRTPYNILSSPDY
VGVTKGCSLENVYIVSFPKPGFVELSPVPFDVGTEINLSFSTKNESGIILLGSDGPNTSP
RRKRRQTGQAYYAIFLNKGRLEVHLSTGVRTMRKIVVKPELIPFHDGREHSIHVERARGM
FTVQVDEDRKHMQNLTVEQSISIKKLFVGGSPSQFQPSPLRTIPPFEGCIWNLVINAIPM
DFAQSVSFKNADIGRCLDHKPGEGEVTSEQIIFPPDSGPEEKETTPAFPFPSPPPTPALA
HGPCAADTKPALLIGSKQFGLSKNSHIAIAFDDTKVKNSLTIEFEIRTEAESGLMFYMAR
INHADFATVQLKNGMPYFSYDLGSGNTSTMISTRINDGQWHKIKIFRTKQEGILYVDGAS
NKTTSPKKADILDVVGMLYVGGLPINYTTRRIGPVVYSIDGCMKNLKMAEAPTDLENPTS
SFNVGTCFANAQKGTYFDGTGFAKAVGAYKVGLDLLVEFEFRTTRTTGVLLGISSQKMDG
MGIELVDEKLMFHVDNGAGRFTATYDAGVPGTLCDGQWHKVTANKIKHRLELKVDGNQVG
AQSSNTASTSADTNDPVFVGGYPDDLNQFGLTTNIPFRGCIRSLKLTKGTAKALEINFAK
ALELKGVQPVSCPAN
Download sequence
Identical sequences F6YJZ2
13616.ENSMODP00000022011 ENSMODP00000022011 ENSMODP00000022011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]