SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022019 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022019
Domain Number 1 Region: 886-1201
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.29e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000122
Further Details:      
 
Domain Number 2 Region: 1161-1459
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-81
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000929
Further Details:      
 
Domain Number 3 Region: 33-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-39
Family MAM domain 0.0000044
Further Details:      
 
Domain Number 4 Region: 392-589
Classification Level Classification E-value
Superfamily Fibronectin type III 3.19e-25
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 289-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000829
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 6 Region: 195-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000161
Family I set domains 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022019   Gene: ENSMODG00000017661   Transcript: ENSMODT00000022406
Sequence length 1461
Comment pep:novel chromosome:BROADO5:2:400414862:401139431:-1 gene:ENSMODG00000017661 transcript:ENSMODT00000022406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAAWALPSFVALVLLAPWPFPGTARAQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVS
SQEPHYLPPEMPQGSYMVVDSSNHDSGEKARLQLPTMKENDTHCIDFSYLLYSQKGMNPG
TLNILVRVNKGPLANPIWNVTGFTGKDWLRAELAVSTFWPNEYQVIFEAEVSDGRNGYIA
IDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVNNKLWLQRRNGEDIPVA
QTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAELIVREPPRPIAPPQLL
GVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYEI
RVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARHIAVDWESLGYNITRCH
TFNVTICYHYFRGHNESKADCLDMDPKAPQHVVSHLPPYTNVSLKMILTNPEGRKESEET
IIQTDEDVPGPVPFKSLKGTSFENKIFLNWKEPLDPNGIITQYEVSYNSIRSFDPAVPVA
GPPQTVTNLWNSTHHVFLHLHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYEG
IDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPHRTKRETGAMECYQVPITYQSA
ISGGSPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKET
KTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVILIVKKSKLA
KKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDSHNFSPRLPNDPLVPTA
VLVPITDENHSAPAESSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDS
YGFKEEYESFFEGQSASWDVAKKDQNRTKNRYGNIIAYDHSRVILQPVEDDPSSDYINAN
YIDIWLYRDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKY
WPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHGVPYHAT
GLLSFIRRVKVSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALR
SRRINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQ
TLNSVTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSY
RQPAAFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDLTQGCPQYWPEEGMLRYGPIQ
VECMSCAMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQV
EKWQEECDEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNM
VEAPEQYRFCYDVALEYLESS
Download sequence
Identical sequences F6YJV4
ENSMODP00000022019 ENSMODP00000022019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]