SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022039 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022039
Domain Number 1 Region: 67-312
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.35e-52
Family Crotonase-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022039   Gene: ENSMODG00000017676   Transcript: ENSMODT00000022426
Sequence length 317
Comment pep:novel chromosome:BROADO5:2:399550589:399631858:-1 gene:ENSMODG00000017676 transcript:ENSMODT00000022426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDHRLGENPATSLEMAASLLKTSSLSLKTKLLHQIGFPLYNSSHGFHEENVKKKLQQF
AGGSIDLQKEDCGIGILTLNNPDKRNAFSGVMMLQLLERVIELENWKEGKGLIVCGAKNT
FCSGSDLNAVKALGTSQDGVELCMFMQNTLTRFMRLPLISVALVQGRAMGGGAEFTTACD
FRLMTPSSEIRFVHKEMGITPSWGGAARLTEIIGSRQALKVLSGALKLDPTIALEIGIAD
EILQSSDEGQSLEEARKWLQQFISGPSEVIRALKTVVSSGKELALEEALETERDVLSTLW
GGPANLEAIAKRKKFYK
Download sequence
Identical sequences F7GFX1
XP_016284372.1.35504 ENSMODP00000022039 ENSMODP00000022039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]