SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022052 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022052
Domain Number 1 Region: 321-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-65
Family SPRY domain 0.0000131
Further Details:      
 
Domain Number 2 Region: 40-108
Classification Level Classification E-value
Superfamily RING/U-box 4.29e-16
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 115-165
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000214
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022052   Gene: ENSMODG00000017686   Transcript: ENSMODT00000022439
Sequence length 503
Comment pep:novel chromosome:BROADO5:1:202735053:202781521:1 gene:ENSMODG00000017686 transcript:ENSMODT00000022439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQKSDKTLTSSPKSSLNADAKEMGKINNTGTTCKANVDDLAKELHCQLCHDWFNKPVM
LHCSHNFCKLCIEKAWKTNQKAVCPECFAPCPGRNYIPNLVLERLMLRIKDMPLLQGQPL
CQEHGENLKLFSKQEGKLACFQCKDVRHSQEFLQINEAVHVYSRKLAISQAQVEASLKEL
QKLKGVQEEEICAHKENKLQLQQNISLEFLKLHQFLNNKEKQLLNELQEMGNALENEMEQ
SLNQLQEQCVLAKEMLVDIQVQLELQNPYDFLVDITAFLGSLEKGIEVLAPRHFISGQLS
LGKFKGPIQYMTWKEMRSILTPDISLITLDPRTAHPNLVISEDQTSVWHGDIKQMIPDNP
ERFDSSVAVLGSEGFTSGKWYWEVEVAKKTKWTVGVVRESINRKGCCPLTPMDGFWLLRL
RNQVELKALDVPSFSMVLKCKLNRVGIYLDYDGGQVSFYNAEELCHIYTFSSTFTEKIFP
YFCPCLNDSGDNLEPLSIIHPMT
Download sequence
Identical sequences F7G5P5
ENSMODP00000022052 ENSMODP00000022052 XP_001366828.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]