SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022195 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022195
Domain Number 1 Region: 277-374
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-25
Family PDZ domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022195
Domain Number - Region: 86-190
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00162
Family Myosin rod fragments 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022195   Gene: ENSMODG00000017803   Transcript: ENSMODT00000022584
Sequence length 459
Comment pep:novel chromosome:BROADO5:2:385862948:385918233:-1 gene:ENSMODG00000017803 transcript:ENSMODT00000022584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGPCSAGPGGVSGGASCASGVPPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQ
ADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLKSELTETQAEKVVLEKEV
HDQLLQLHSVQLQLHAKTGQSVDSGTIKAKLSVPSVEELERELEANKKEKMKEAQLEAEV
KLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQ
LEAEIHLHRHKTVIRACRGRNDLKRSMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGL
GISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDAKHKEAVTILSQQ
RGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGSGNPVAHRKGASGDIKLLQ
GFNKKPVIDGHENGDLGTSSETPLNDSASKLAESAESLS
Download sequence
Identical sequences F7CFH2
ENSMODP00000022195 ENSMODP00000022195 XP_001379678.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]