SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022215 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022215
Domain Number 1 Region: 28-492
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.05e-94
Family L-arabinose binding protein-like 0.0000457
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022215
Domain Number - Region: 514-562
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000471
Family TNF receptor-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022215   Gene: ENSMODG00000017819   Transcript: ENSMODT00000022604
Sequence length 929
Comment pep:novel chromosome:BROADO5:2:385004915:385030777:-1 gene:ENSMODG00000017819 transcript:ENSMODT00000022604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLRILFPYFVTIFNLSQPCQIPDDFVAASSPGHIVIGGLFAVHNKMIHSEEYPTRPEI
QTCEGFEISIFLQALAMIHSIEIINNSSLLPGVKLGYEIYDTCTEVTIAIAATLRFLSKF
NCTQDIVEFHCNYSNYTPRVKAVIGTSYSEITIAVSRMLNLQLIPQVSHASTAEILSDKI
RFPSFFRTAPSDFYQTKAMAHLIQKSGWNWIGIITTDDDYGRLALGTFGMQASANNVCIA
FREILPAFLSDSTIEVKINQTLEKIMEESHVNVIVVFLRQFHVFDLFNKAIQRNINKVWI
ASDTWSAAVKISTIPNVKRIGKVVGFAFKSGNMSSFHDFLQNIHLLSNEKNKLLSEYIML
LSSCSHVKDSDLNYCIANHSQGNWAYKIVESNFSLRNNFLLDNAEPGPVHSLQLAISALA
YAIRDQCRDRNCQNPTAFHPWELLEALKNVTFTDGKNEFQFDSQGDINTGYDVLLWKEVD
GRMTIITMAEYDLEKDDFIFKDNGTEKEFRNLKKIQSKCSRECTPGQMKKTTQSPHTCCY
ECVSCPENYYTNQTDMDYCLLCDNKTHWAPVNSTVCFEKEVEYLNWNDWFAIMLLTLSTL
GIICTFAVGIIFTRNLNTPVVKSSGGLIICYVILLCHFFNFVSTSLFVGEPQDFKCKTRQ
TLFGMSFALCISCILTKSLKILLAFSFEPRLQKCLKRLYKPIPIIVICTGIQMIICTIWL
LFAAPFVEENFSIPRVIILECDEGSIMALGTMLSYIAILAFICFISAFKGRKLPANYNEA
KFITFGMLIYFISWIIFIPVYATTFGKYLPAVEIIVILISNYGILCCTFFPKCYIILCKQ
ETNTKSAFLKTLYTYSSQSACSLNVSHISLDSGPSEDSLPNQNFHCKTPGTSEQGKVSQA
QMAKHVQSPRKRTAKNMIGILPRKRTSSI
Download sequence
Identical sequences F6ZXM6
13616.ENSMODP00000022215 ENSMODP00000022215 XP_007484529.1.35504 ENSMODP00000022215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]