SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022293 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022293
Domain Number 1 Region: 1498-1683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.13e-34
Family Laminin G-like module 0.00039
Further Details:      
 
Domain Number 2 Region: 1318-1495
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.61e-34
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 911-1092
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.09e-23
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 1088-1266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-21
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 5 Region: 695-891
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-17
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 6 Region: 49-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 7-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022293
Domain Number - Region: 516-665
Classification Level Classification E-value
Superfamily Tropomyosin 0.00915
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022293   Gene: ENSMODG00000017881   Transcript: ENSMODT00000022683
Sequence length 1684
Comment pep:novel chromosome:BROADO5:2:378396846:378598763:-1 gene:ENSMODG00000017881 transcript:ENSMODT00000022683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANFAVSCYRKSGVIRCICKEKYAGPNCERCAPGYYGNPLLIGSTCKKCDCSGNSDPNLI
FEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAVCNCGGGPCDSETGECLEE
SFEPPTGMDCPTISCDKCIWDLTDDLRLAALAIDESKSNLLSVSSGVAAHRHVNEINSTV
YLLKAKFSERENQYILRKIQISDAENTMKGLQSDLEELAEKENQAAKKSQLVQQETMDTI
NYATQLVEDAHNMRDKIQEISSKMLYYGVKQDLGPEEISEKLVLAENMLEELRHRKPFLT
QRDLVDEEADEAQELLSLAENWQRLHNDTRSLFPVVLEQLDDYDAKLSELQESLDESLDR
ARDAEDMNRANAAKQRDNEKQHERVKEQVAMVNISLSESAESLETPRLTISELSDIIQNA
SGIYAEIDGAKKELQDKFSNLTTLDHDLVQRAMEHAEDLQQQADELNRSLHRLDTNGLVQ
KALDASNVYENIINYVHEANESAVLALSITDRVSDAVGGIDTQITYHKDESENLLSQAKT
LQATADSSNEQAVADTSQRVGGALARKSFLKNRLNEAIKKLQAAERGDAERRLDHSKRII
AEAEKTTMEVGQATTPMVNNLNTWSQSLHHFDSSAYNTAVDSARDAVRNLTEVVPQLLDQ
LRTVEQKRPASNVSDSIRRIRELIAQTRSVASKIQVSMMFDGQSAVEVNTKTNVDDLKAF
TSMSLYMKPPEKSAGKNENADRFILYLGSKNAKSDYMGLAIKNDNLVYIYNLGNKDVEIP
LDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGEVSGDDSLLDLQPE
DTVFYVGGVPPNFKLPASLNLPGFVGYLELATLNNEVISLYNFKHIYNMDPSKSIPSARD
KLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEVRTPVANGLVLLMVNGSTFF
SLEMRNGYLNVFYDFGFSNGPVHLEDSQKKAPINDAKYHEISIIYHNDKKMILVVDRRHV
KSMDNEKMKIPFTDIYIGGVPPEVFQSSNIKAHLPLDVNFRGCMKGFQFQKKDFNLLEQP
ETLGVGYGCPEDSLISRRAYFNGQGFIASSQKISFFDAFEGGFNFRTLQPNGLLLYYAAG
SDIFSISMDKGTVILNVKGIKVQTTDKQYDDGQSHFIIASISPTRYELIVDKDKLGKNNP
TKGKTEQTPVSESKFYFGGSPISSQYANFTGCISNAYFTRLDRDVEVEDFQRYSEKVHTS
LYECPIESAPVSLLHKKGKNSSKPKVNKNKKNEKNKDSPRDPVGLKSLKQNISRDSHCQL
SSSPKAIAHAYQYGGTANSRQEFEHLKGNFAEKSQFSIRLKTRSSHGMIFYVSDQEENDF
MTLFVAHGRLVFMFNVGHRKLKLRSQEKYNDGLWHDVIFIREKNSGRLIIDGLRVLEESF
PPTGTAWKVEGPIYLGGVAPGKAVKNVQINSVYSFSGCLSNLQLNGTSITTASQTFSVTP
CFEGPMESGTYFSAEGGYVILDESFNIGLKFEIAFEVRPRSSSGILVHGHSVNGEYLNVH
MKNGQVIAKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNVVQLDVDSEVNHVVGPLN
PKSVDHREPVFVGGVPESLLTPSLTAIRPFTGCLRNFVIDERPVSFSKAALVSGAVSINS
CPAA
Download sequence
Identical sequences F6YHF2
ENSMODP00000022293 ENSMODP00000022293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]