SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022337 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022337
Domain Number 1 Region: 342-687
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.22e-91
Family YicI catalytic domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 691-773
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-19
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 3 Region: 72-161,209-339
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000000129
Family YicI N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022337   Gene: ENSMODG00000017915   Transcript: ENSMODT00000022727
Sequence length 912
Comment pep:novel chromosome:BROADO5:1:199707034:199780653:1 gene:ENSMODG00000017915 transcript:ENSMODT00000022727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAGSEDAISFQDEAVDKSIFKDCNKIGFYRRQKLLPRKNTYRALLDSVTSGKDSTKFQ
IINEVNKVPLLAEVYGIEGNIFRLKINEMAPLNPRYEISDVLIQKPATKRLTPCPGDTGT
LVLKDDSGNLKFHISANPFKIDLSSEEEPVLSINSTGRLYFEHLQMPPKHRISKEEDVMT
DPSQESQDDLGLWQEKFGKFVDIKANGPSAIGLDFSLHGFEHLYGIPQHAETHQLKNTSA
GEAYRLYNLDVYGYKIHDKMGIYGCVPYLLAHKQGRTVGIFWLNASETLVEINTQPTVEH
MLSQEGSVLAKQKVKAQTDVCWMSESGIIDVFLLMGPTPAAVFKQYSVLTGTQALPPLFS
LGYHQCRWNYDDEQDVKAVDAGFDAHDIPYDVIWLDIEHTEGKRYFTWDKKKFPDPKRMQ
ELIRSKKRKVVVITDPHIKVDPMYSLYSQAKDKGYFVKNNKGGDFEGVCWPGASSYLDFT
NPKVREWYSGLFAFSEYQGSTDILFIWNDMNEPSVFRGPELTMEKNAIHYGNWEHRDLHN
MYGFYQQMAAAEGLIQRSNGEERPFVLTRSFFAGSQKYGAVWTGDNKAEWGYLKISIPML
LTLSVAGIAFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHATMDTKRREPWLFGEEN
TQLIRNAIKERYALLPYWYSLFYHAHVASKPVMRPLWVEFPKELETFDVEDEYMLGSALL
IHPVTEPKATMVDVLLPGSEEVWYDFRTFVHWEGARTLKFPVALDSTPVFQRGGSVIPMK
TAVGRSTGWMPRLPYELRVALDSQGSARGELYLDDGHSFQYLHQKQFLHRKFLFSAGVLS
SSGADENGHYHSECVVEKVVILGINKQPSSVTASCPDMADTQVAFTYGSKTSVLRLEKLS
LNVGVDWEIHIK
Download sequence
Identical sequences F7F2Q7
ENSMODP00000022337 ENSMODP00000022337 XP_001362744.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]