SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022511 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022511
Domain Number 1 Region: 352-442
Classification Level Classification E-value
Superfamily DEATH domain 7.65e-20
Family DEATH domain, DD 0.0001
Further Details:      
 
Domain Number 2 Region: 96-129
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000173
Family TNF receptor-like 0.00077
Further Details:      
 
Domain Number 3 Region: 39-97
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000259
Family TNF receptor-like 0.00053
Further Details:      
 
Domain Number 4 Region: 143-194
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000199
Family TNF receptor-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022511   Gene: ENSMODG00000018056   Transcript: ENSMODT00000022904
Sequence length 453
Comment pep:novel chromosome:BROADO5:8:107654952:107674220:-1 gene:ENSMODG00000018056 transcript:ENSMODT00000022904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPTLPGLLPLVALALMVGLYFHVASGMSIQKRHQENCPEGKYEHRTNASICCLKCHKG
TYLNADCGDSGLAPDCKTCPNGTFTERENYVSKCLSCSICRKEMGQIEKTPCTISRNTVC
GCGENQYQQSQGKEENGLFKCVPCNPCFNGTIQRPCQEKQDAVCLCNPDFFWNGDKCISC
NECLPGEKCSPFCPSKSMDPGETVPVLMVLVIFLGFCCLSLIVTVFFCQYSRWKSKLYLI
VCPRKAPEKEEEHGQSLAPSLKSDSTPISTQVPSYSPGTPCPGPSFQVHSSTPLRAPAPS
LNSSFYSLPPNNWQPPINIQRTEWAPLPDPINCSAQMPSHSATSDDTALRLDHPAMLYTV
VDQVPPQRWKEFVRRLGLSPNAIEFLEMQNSRCLREAHYSMLEAWQKGVPRHQATLETLA
LVLQEMKLCGCLQNIREALEQDSPCRPRTPFPR
Download sequence
Identical sequences F7G4G9
ENSMODP00000022511 ENSMODP00000022511 XP_016281389.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]