SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022515 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022515
Domain Number 1 Region: 42-96
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000628
Family TNF receptor-like 0.0024
Further Details:      
 
Domain Number 2 Region: 98-144
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000942
Family TNF receptor-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022515   Gene: ENSMODG00000018059   Transcript: ENSMODT00000022908
Sequence length 431
Comment pep:novel chromosome:BROADO5:8:107757606:107763404:1 gene:ENSMODG00000018059 transcript:ENSMODT00000022908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPQACSLQGLLRGPLLLGLFGLLAGQQLRQGPPDTKCADQQYYEPRHEVCCSRCPPGM
HVLEFCNRHRNTTCAPCPPRSYNEFWNHINVCQLCRPCDKVLGFEEVAPCNASRKTQCRC
RQGMYCPNGGTDCEHCEPLSSCPPGTEPELTGVHLASKIVRRSLKQRNWDKIGEFDNNCV
PCSDGYFQNISSPDVRCQPHTNCEAQGLVTSVPGTAVSDARCQNSPPKMPGTILLLSVLV
PMASILLLISVFSCAWKRHPSLCRKLGLLLKRRPEREDPNPPPNQDIPRTNQKYPDLVEL
LLDSSGTAPVALNGHPPSPAMETEPLRQQSPPDQGRDQGTEPGEQGQEVHHGTNGFLVSG
GSVTVKGNIYIYNGPVLGGARGPGDPPLSPDPPYPVPEEGTPNLLRFSEPHQEDGKAWHL
AETETLGCYAH
Download sequence
Identical sequences F7G4F9
ENSMODP00000022515 XP_007503709.1.35504 ENSMODP00000022515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]