SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022516 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022516
Domain Number 1 Region: 31-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000571
Family TNF receptor-like 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022516
Domain Number - Region: 82-123
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000131
Family TNF receptor-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022516   Gene: ENSMODG00000018060   Transcript: ENSMODT00000022909
Sequence length 268
Comment pep:novel chromosome:BROADO5:8:107823695:107826401:1 gene:ENSMODG00000018060 transcript:ENSMODT00000022909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KASGSSWWLWVLGTLVGLSPGTIAKRHCLQGEYQVEQRSWCCRLCDPGTYLVRDCDGDRK
DPQCKPCTPGLSFTPDHHAQRQCESCRICNGLTIQNCNITRNSECACPKGQQCQDKECTS
CDPQPTYLQSTPQYPFRGIHQHPNPFHLSMLSGNWESESVGEEEEEDYRKTGARGIVLHW
PPSVLSGPSNPISIYTLLVLYGLVLALLVAGTWQILKQRACQLKKKQEPVKLCPAESGVA
PGPYCPKQEVSTLPIQEDYRKPDPDSCP
Download sequence
Identical sequences F7G4F6
13616.ENSMODP00000022516 ENSMODP00000022516 ENSMODP00000022516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]