SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022529 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022529
Domain Number 1 Region: 378-498
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.18e-18
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000000706
Family Myosin rod fragments 0.0000319
Further Details:      
 
Domain Number 3 Region: 583-696
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000549
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number 4 Region: 765-973
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000916
Family Tropomyosin 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022529
Domain Number - Region: 528-608
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000602
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022529   Gene: ENSMODG00000018070   Transcript: ENSMODT00000022923
Sequence length 1029
Comment pep:novel chromosome:BROADO5:4:68016638:68184252:-1 gene:ENSMODG00000018070 transcript:ENSMODT00000022923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVEKEVIIFKEELAKLNKALRKAKYSKEECEAKSIFLILKKNDFFLQLQTEQDTLADVER
TTLIKSKIQLEAKVKELSELVKEEDRLNSKLNARRRELEDECPELKKEIDDLETTLVKPD
KEKRSTKHKAFSPSKEGGLVAHMPVLQAIKVTNEAHRWALSKVQVEEDLLLTLSKKTKLK
LEQAKEAIISLRTEKKTKMELDWKKQKEESDIDLSQESTMDLQDDHQHMDEISEKIYFLT
ALPSVLESILKKSLLLCQARTVELEEELEAEKTTQAKVEKQRSDLAHELEEMNKQLEEAR
GTSLAQLEINKKREAEFVRLRRDLDEATFHFDSTAAAIRKKHEDSLEELKGQVDNLQWVR
QSLEKEKSELKLEVEGLLNNVEKIAKAKSKAEKLCRLFESQLSETNTRLEEMTKLINDVT
TQKSKLESEKDEFTRKLEEKESLINQLSRGTNNFTQQIEEMRRVLEQETESKKLLAHALQ
LAKRDYDLLKGQYREEQEAKTKLLWALTKGRAEVVQWRTHYESHTLQRKEDFEEAKKKLA
SRLQEAGEAIQEANAKSTSLEKTKQRLQLELEDVVSDLEKVHSTAAILDEKQKNFDKILT
DWKQKYEDSHADLEASQMEARNISEELFQLKQAYEEVIVNQETLKRENKNLHEEISDLTE
QIMEGNKNLHELEKVKRLAEQEKSEAQVALEEAEGVLEREESKILHFQFEVLEAKVELER
KLVEKEEEIENLRRDQQRTIDSLQSTLHSEAKSQAEASRLKKKMEGDLNEMELQLSHANR
QTSEASKSLNTLHMQIKHLQVQVDETTRHNDSLKEEVMVAERQHAILQSEVEELRALQEQ
TERGRRLAEQELLEATEKLNMLHTQNTSLLSLKKKLETDIACMKKELENATEERRSAEEK
AKKSSTDATLLTESLKKEQYTCSHLERIRNNMEQTIVDLQKRLEDAEQSTLKGGSKQIQK
LESRIRELECKLESEVRRSSEAQNGARKFETSIKELTFQAEEDKKNLNRMQNLIDRLQLK
VKSYKHQVE
Download sequence
Identical sequences F7G464
13616.ENSMODP00000022529 ENSMODP00000022529 ENSMODP00000022529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]