SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022618 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000022618
Domain Number - Region: 152-254,372-432
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000147
Family beta-glycanases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022618   Gene: ENSMODG00000018142   Transcript: ENSMODT00000023016
Sequence length 456
Comment pep:novel chromosome:BROADO5:2:355875737:355973246:1 gene:ENSMODG00000018142 transcript:ENSMODT00000023016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFRRRTCIILSLFILLICSLMMALKTLRPDRAVFGDPFGLDLLPELRQHTVHLETKPG
MSNGARDDSITNIKNIKSIAVNSLKVPVMAEMNMEELPAPNYNLHAFYYSWYGNPQFDGK
YLHWNHPILPHWDPQIAKNYPEGNHIPPDDIGSNFYPELGTYSSRDPYIIETHMKQMRSA
SIGVIALSWYPRGLADKEGESTDELVPSILDNAHKYNLKVTFHIEPYKNRDDHSMHKIIK
YIIDKYGSHPAFYRYKTKTGRVLPMFYVYDSYFTKPETWANLLTASGPLSVRNTPYDGLF
IALLVEERHKQEIQRSGFDGIYTYFATNGFSYGSSHHNWAVLKAFCDSNSLLFIPSVGPG
YIDINIRPWNNHNTRNRINGKYFETAFSAALQVQPDAISITSFNEWHEGTQIEKAVPKRT
ELTVYLDYQPHKPGIYLELTRKWSEKYNKEKEQWLA
Download sequence
Identical sequences F7CXN8
ENSMODP00000022618 XP_001377143.1.35504 ENSMODP00000022618 13616.ENSMODP00000022618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]